PTH2R Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88101

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all PTH2R Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human PTH2R. Peptide sequence: NSEQDCLPHSFHEETKEDSGRQGDDILMEKPSRPMESNPDTEGCQGETED The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for PTH2R Antibody - BSA Free

Western Blot: PTH2R Antibody [NBP2-88101]

Western Blot: PTH2R Antibody [NBP2-88101]

Western Blot: PTH2R Antibody [NBP2-88101] - WB Suggested Anti-PTH2R Antibody. Titration: 1.0 ug/ml. Positive Control: OVCAR-3 Whole CellPTH2R is supported by BioGPS gene expression data to be expressed in OVCAR3

Applications for PTH2R Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PTH2R

PTHR2, a Parathyroid Hormone Receptor, binds parathyroid hormone (PTH), parathyroid hormone-related peptide, and tuberoinfundibular peptide 39 (TIP39). However, parathyroid hormone-related peptide does not activate the receptor. The physiologic role of PTHR2 and its possible role in disease remained to be determined. PTHR2 has been reported in brain. ESTs have been isolated from normal testis libraries as well as cancer libraries from bone marrow, brain, germ cell, head/neck, and skin.

Long Name

Parathyroid Hormone 2 Receptor

Alternate Names

PTHR2

Gene Symbol

PTH2R

Additional PTH2R Products

Product Documents for PTH2R Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PTH2R Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PTH2R Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PTH2R Antibody - BSA Free and earn rewards!

Have you used PTH2R Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies