PTP rho/PTPRT Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-09421

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all PTP rho/PTPRT Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PTP rho/PTPRT (NP_008981.4). Peptide sequence QQFQFLGWPMYRDTPVSKRSFLKLIRQVDKWQEEYNGGEGRTVVHCLNGG

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for PTP rho/PTPRT Antibody - BSA Free

Western Blot: PTP rho/PTPRT Antibody [NBP3-09421]

Western Blot: PTP rho/PTPRT Antibody [NBP3-09421]

Western Blot: PTP rho/PTPRT Antibody [NBP3-09421] - Western blot analysis of PTP rho/PTPRT in 293T Whole Cell lysates. Antibody dilution at 1.0ug/ml

Applications for PTP rho/PTPRT Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PTP rho/PTPRT

PTPRT is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP is a large protein that possesses a PTP domain at C-terminus, and multiple noncatalytic domains, which include a domain with similarity to band 4.1 superfamily of cytoskeletal-associated proteins, a region consisting of five PDZ domains, and a leucine zipper motif. This PTP was found to interact with, and dephosphorylate Fas receptor, as well as I-kappa B-alpha through the PDZ domains, which suggested its role in Fas mediated programmed cell death. This PTP was also shown to interact with GTPase-activating protein, and thus may function as a regulator of Rho signaling pathway. Four alternatively spliced transcript variants, which encode distinct proteins, have been reported.

Long Name

Protein Tyrosine Phosphatase Receptor-type T

Alternate Names

PTPRT, RPTP-rho

Gene Symbol

PTPRT

Additional PTP rho/PTPRT Products

Product Documents for PTP rho/PTPRT Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PTP rho/PTPRT Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Epigenetics
Phosphatases and Regulators

Customer Reviews for PTP rho/PTPRT Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PTP rho/PTPRT Antibody - BSA Free and earn rewards!

Have you used PTP rho/PTPRT Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies