PTPRD Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-49153

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Mouse

Predicted:

Rat (99%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all PTPRD Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: GREVELKPYIAAHFDVLPTEFTLGDDKHYGGFTNKQLQSGQEYVFFVLAVMEHAESKMYATSPYSDPVVSMDLDPQPITDEEE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit PTPRD Antibody - BSA Free (NBP2-49153) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for PTPRD Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: PTPRD Antibody [NBP2-49153]

Immunocytochemistry/ Immunofluorescence: PTPRD Antibody [NBP2-49153]

Immunocytochemistry/Immunofluorescence: PTPRD Antibody [NBP2-49153] - Staining of human cell line RH-30 shows localization to vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: PTPRD Antibody [NBP2-49153]

Immunohistochemistry-Paraffin: PTPRD Antibody [NBP2-49153]

Immunohistochemistry-Paraffin: PTPRD Antibody [NBP2-49153] - Staining of mouse brain shows moderate cytoplasmic positivity in mitral cell layer in olfactory bulb.
Immunohistochemistry-Paraffin: PTPRD Antibody [NBP2-49153]

Immunohistochemistry-Paraffin: PTPRD Antibody [NBP2-49153]

Immunohistochemistry-Paraffin: PTPRD Antibody [NBP2-49153] - Staining of human adrenal gland shows moderate cytoplasmic positivity in glandular cells in medulla.
Immunohistochemistry-Paraffin: PTPRD Antibody [NBP2-49153]

Immunohistochemistry-Paraffin: PTPRD Antibody [NBP2-49153]

Immunohistochemistry-Paraffin: PTPRD Antibody [NBP2-49153] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: PTPRD Antibody [NBP2-49153]

Immunohistochemistry-Paraffin: PTPRD Antibody [NBP2-49153]

Immunohistochemistry-Paraffin: PTPRD Antibody [NBP2-49153] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: PTPRD Antibody [NBP2-49153]

Immunohistochemistry-Paraffin: PTPRD Antibody [NBP2-49153]

Immunohistochemistry-Paraffin: PTPRD Antibody [NBP2-49153] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Applications for PTPRD Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PTPRD

The protein encoded by the PTPRD gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP contains an extracellular region, a single transmembrane segment and two tandem intracytoplasmic catalytic domains, thus represents a receptor-type PTP. The extracellular region of this protein is composed of three Ig-like and eight fibronectin type III-like domains. Studies of the similar genes in chick and fly suggest the role of this PTP is in promoting neurite growth, and regulating neurons axon guidance. Multiple tissue specific alternatively spliced transcript variants of this gene have been reported. (provided by RefSeq)

Long Name

Protein Tyrosine Phosphatase Receptor-type delta

Alternate Names

PTP delta, PTP-delta, PTPD, PTPdelta, R-PTP-Delta, RPTP-Delta

Gene Symbol

PTPRD

Additional PTPRD Products

Product Documents for PTPRD Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PTPRD Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Epigenetics
Phosphatases and Regulators

Customer Reviews for PTPRD Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PTPRD Antibody - BSA Free and earn rewards!

Have you used PTPRD Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies