Purine Nucleoside Phosphorylase/PNP Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-54353

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Purine Nucleoside Phosphorylase/PNP Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to NP(nucleoside phosphorylase) The peptide sequence was selected from the middle region of NP. Peptide sequence GVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFG. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Purine Nucleoside Phosphorylase/PNP Antibody - BSA Free

Western Blot: Purine Nucleoside Phosphorylase/PNP Antibody [NBP1-54353]

Western Blot: Purine Nucleoside Phosphorylase/PNP Antibody [NBP1-54353]

Western Blot: Purine Nucleoside Phosphorylase/PNP Antibody [NBP1-54353] - Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.
Western Blot: Purine Nucleoside Phosphorylase/PNP Antibody [NBP1-54353]

Western Blot: Purine Nucleoside Phosphorylase/PNP Antibody [NBP1-54353]

Western Blot: Purine Nucleoside Phosphorylase/PNP Antibody [NBP1-54353] - THP-1 cell lysate, concentration 0.2-1 ug/ml.
Western Blot: Purine Nucleoside Phosphorylase/PNP Antibody [NBP1-54353]

Western Blot: Purine Nucleoside Phosphorylase/PNP Antibody [NBP1-54353]

Western Blot: Purine Nucleoside Phosphorylase/PNP Antibody [NBP1-54353] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.
Western Blot: Purine Nucleoside Phosphorylase/PNP Antibody [NBP1-54353]

Western Blot: Purine Nucleoside Phosphorylase/PNP Antibody [NBP1-54353]

Western Blot: Purine Nucleoside Phosphorylase/PNP Antibody [NBP1-54353] - MCF7, Antibody Dilution: 1.0 ug/ml PNP is supported by BioGPS gene expression data to be expressed in MCF7.

Applications for Purine Nucleoside Phosphorylase/PNP Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Purine Nucleoside Phosphorylase/PNP

Defects in NP are the cause of nucleoside phosphorylase deficiency (NP deficiency). It leads to a severe T-cell immunodeficiency with neurologic disorder in children. The specific function of NP is not yet known.This gene encodes an enzyme which reversibly catalyzes the phosphorolysis of purine nucleosides. The enzyme is trimeric, containing three identical subunits. Mutations which result in nucleoside phosphorylase deficiency result in defective T-cell (cell-mediated) immunity but can also affect B-cell immunity and antibody responses. Neurologic disorders may also be apparent in patients with immune defects. A known polymorphism at aa position 51 that does not affect enzyme activity has been described. A pseudogene has been identified on chromosome 2. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Alternate Names

Inosine phosphorylase, PUNP

Gene Symbol

PNP

UniProt

P00491

Additional Purine Nucleoside Phosphorylase/PNP Products

Product Documents for Purine Nucleoside Phosphorylase/PNP Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Purine Nucleoside Phosphorylase/PNP Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Purine Nucleoside Phosphorylase/PNP Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Purine Nucleoside Phosphorylase/PNP Antibody - BSA Free and earn rewards!

Have you used Purine Nucleoside Phosphorylase/PNP Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies