PWP2H Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-52844

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all PWP2H Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to PWP2(PWP2 periodic tryptophan protein homolog (yeast)) The peptide sequence was selected from the middle region of PWP2. Peptide sequence VQTGSIEGRHDLKTGRKELDKITAKHAAKGKAFTALCYSADGHSILAGGM. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for PWP2H Antibody - BSA Free

Western Blot: PWP2H Antibody [NBP1-52844]

Western Blot: PWP2H Antibody [NBP1-52844]

Western Blot: PWP2H Antibody [NBP1-52844] - Sample Type: MCF7 Antibody Dilution: 1.0 ug/ml PWP2 is supported by BioGPS gene expression data to be expressed in MCF7
Western Blot: PWP2H Antibody [NBP1-52844]

Western Blot: PWP2H Antibody [NBP1-52844]

Western Blot: PWP2H Antibody [NBP1-52844] - Analysis of 721_B cell lysate. Antibody Dilution: 1.0 ug/ml PWP2 is supported by BioGPS gene expression data to be expressed in 721_B.
Western Blot: PWP2H Antibody [NBP1-52844]

Western Blot: PWP2H Antibody [NBP1-52844]

Western Blot: PWP2H Antibody [NBP1-52844] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:62500 Positive Control: HepG2 cell lysate

Applications for PWP2H Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PWP2H

PWP2 belongs to the WD repeat PWP2 family. It contains 14 WD repeats. The exact function of PWP2 is not known.

Alternate Names

periodic tryptophan protein 2 homolog, PWP2 (periodic tryptophan protein, yeast) homolog, PWP2 periodic tryptophan protein homolog (yeast), PWP2HEHOC-17

Gene Symbol

PWP2

UniProt

Q15269 (Human)

Additional PWP2H Products

Product Documents for PWP2H Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PWP2H Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PWP2H Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PWP2H Antibody - BSA Free and earn rewards!

Have you used PWP2H Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies