PYHIN1 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-79436
Loading...
Key Product Details
Species Reactivity
Human
Applications
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
Synthetic peptide directed towards the N terminal of human PYHIN1The immunogen for this antibody is PYHIN1. Peptide sequence KMKEEYDKIQIADLMEEKFPGDAGLGKLIEFFKEIPTLGDLAETLKREKL. The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
51 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Scientific Data Images for PYHIN1 Antibody - BSA Free
Western Blot: PYHIN1 Antibody [NBP1-79436]
Western Blot: PYHIN1 Antibody [NBP1-79436] - 721_B cell lysate, concentration 0.2-1 ug/ml.Western Blot: PYHIN1 Antibody - BSA Free [NBP1-79436] -
Silencing NKD2 induces EMT in CAL‐27 cells with overexpressed or silenced IFIX. (A) qRT‐PCR analysis quantifying NKD2 expression in CAL‐27 cells with stable expression of shRNA molecules. NKD2 expression levels in CAL‐27 cells with various treatments, including control, overexpressed IFIX (OE‐IFIX) and silenced IFIX (shIFIX), are shown. (B) Western blot analysis of NKD2 and IFIX protein levels in CAL‐27 cells with different treatments: vector control, OE‐IFIX, NC + NC, sh‐NKD2 and OE‐IFIX + sh‐NKD2. (C) Quantification of IFIX protein levels from Western blot analysis. (D) Quantification of NKD2 protein levels from Western blot analysis. (E) Western blot analysis of EMT markers (E‐cadherin, N‐cadherin, Snail and vimentin) in response to IFIX silencing by siRNA molecules in CAL‐27 cells with different treatments. (F‐I) Quantification of E‐cadherin, N‐cadherin, vimentin and Snail protein levels from Western blot analysis. Vector: OE‐IFIX CAL‐27‐vector cells; OE‐IFIX: overexpressed IFIX‐CAL‐27 cells; sh‐NKD2: Sh‐NKD2‐CAL‐27 cells; NC + NC: OE‐IFIX‐CAL‐27‐vector + sh‐NKD2 CAL‐27‐vector cells; OE‐IFIX + sh‐NKD2: OE‐IFIX + sh‐NKD2‐CAL‐27 cells. Error bars indicate mean +/- SD. *p < 0.05, **p < 0.01, ***p < 0.001, ****p < 0.0001. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/39833105), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: PYHIN1 Antibody - BSA Free [NBP1-79436] -
Effects of NKD2 and IFIX on tumour growth and EMT in vivo. (A) Tumour growth curves of SCC‐25 cells with stable expression of sh‐NKD2, OE‐IFIX, OE‐IFIX + sh‐NKD2 or NC + NC grafted into nude mice (n = 4). Tumour volume was measured over time. Error bars indicate mean +/- SD. *p < 0.05, **p < 0.01, ***p < 0.001, ****p < 0.0001. (B) Images of tumours excised from nude mice at the end of the experiment. (C) Immunohistochemistry (IHC) analysis of EMT markers (E‐cadherin, N‐cadherin, vimentin and Snail) and NKD2 expression in tumour tissues from NC + NC, sh‐NKD2, OE‐IFIX and OE‐IFIX + sh‐NKD2 groups. Images captured at 20× magnification. (D) Western blot analysis of IFIX and NKD2 protein levels in tumour tissues, with GAPDH as a loading control. (E) Quantification of tumour weights from excised tumours. Error bars indicate mean +/- SD. *p < 0.05, **p < 0.01, ***p < 0.001, ****p < 0.0001. (F) Quantification of relative protein levels of IFIX and NKD2 from Western blot analysis. Error bars indicate mean +/- SD. *p < 0.05, **p < 0.01, ***p < 0.001, ****p < 0.0001. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/39833105), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: PYHIN1 Antibody - BSA Free [NBP1-79436] -
Validation of knockdown and overexpression of IFIX in CAL‐27 and SCC‐25 cells. (A,B) qRT‐PCR analysis results showing relative IFIX mRNA expression levels in CAL‐27 and SCC‐25 cell lines. (C–F) Western blot analysis and its quantification showing relative IFIX protein expression levels in CAL‐27 and SCC‐25 cells stably expressing shRNA molecules. Each qRT‐PCR and Western blot experiment was repeated three times, and data are presented as mean +/- standard error (SE), ****p < 0.0001**p < 0.01. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/39833105), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: PYHIN1 Antibody - BSA Free [NBP1-79436] -
Validation of knockdown and overexpression of IFIX in CAL‐27 and SCC‐25 cells. (A,B) qRT‐PCR analysis results showing relative IFIX mRNA expression levels in CAL‐27 and SCC‐25 cell lines. (C–F) Western blot analysis and its quantification showing relative IFIX protein expression levels in CAL‐27 and SCC‐25 cells stably expressing shRNA molecules. Each qRT‐PCR and Western blot experiment was repeated three times, and data are presented as mean +/- standard error (SE), ****p < 0.0001**p < 0.01. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/39833105), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for PYHIN1 Antibody - BSA Free
Application
Recommended Usage
Western Blot
1.0 ug/ml
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: PYHIN1
Alternate Names
IFIXMGC23885, Interferon-inducible protein X, pyrin and HIN domain family, member 1, pyrin and HIN domain-containing protein 1, RP11-520H16.1
Gene Symbol
PYHIN1
UniProt
Additional PYHIN1 Products
Product Documents for PYHIN1 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for PYHIN1 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for PYHIN1 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review PYHIN1 Antibody - BSA Free and earn rewards!
Have you used PYHIN1 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...