Pyruvate Dehydrogenase E2 Antibody (2Z7R10)

Novus Biologicals | Catalog # NBP3-16707

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 2Z7R10 expressed in HEK293
View all Pyruvate Dehydrogenase E2 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 548-647 of human Pyruvate Dehydrogenase E2 (P10515). AREGKLQPHEFQGGTFTISNLGMFGIKNFSAIINPPQACILAIGASEDKLVPADNEKGFDVASMMSVTLSCDHRVVDGAVGAQWLAEFRKYLEKPITMLL

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Pyruvate Dehydrogenase E2 Antibody (2Z7R10)

Western Blot: Pyruvate Dehydrogenase E2 Antibody (2Z7R10) [NBP3-16707]

Western Blot: Pyruvate Dehydrogenase E2 Antibody (2Z7R10) [NBP3-16707]

Western Blot: Pyruvate Dehydrogenase E2 Antibody (2Z7R10) [NBP3-16707] - Western blot analysis of extracts of various cell lines, using Pyruvate Dehydrogenase E2 Rabbit mAb (NBP3-16707) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1min.

Applications for Pyruvate Dehydrogenase E2 Antibody (2Z7R10)

Application
Recommended Usage

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Pyruvate Dehydrogenase E2

The DLAT gene encodes dihydrolipoamide acetyltransferase (EC 2.3.1.12), the E2 subunit of the mammalian pyruvate dehydrogenase complex (PDC; EC 1.2.4.1) of the inner mitochondrial membrane. Patients with primary biliary cirrhosis (PBC; MIM 109720) show autoantibodies to DLAT.[supplied by OMIM]

Alternate Names

70 kDa mitochondrial autoantigen of primary biliary cirrhosis, dihydrolipoamide S-acetyltransferase, DLTA, E2 component of pyruvate dehydrogenase complex, EC 2.3.1, M2 antigen complex 70 kDa subunit, PBC, PDC-E2EC 2.3.1.12, PDCE2mitochondrial

Gene Symbol

DLAT

Additional Pyruvate Dehydrogenase E2 Products

Product Documents for Pyruvate Dehydrogenase E2 Antibody (2Z7R10)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Pyruvate Dehydrogenase E2 Antibody (2Z7R10)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Pyruvate Dehydrogenase E2 Antibody (2Z7R10)

There are currently no reviews for this product. Be the first to review Pyruvate Dehydrogenase E2 Antibody (2Z7R10) and earn rewards!

Have you used Pyruvate Dehydrogenase E2 Antibody (2Z7R10)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies