RAB19B Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85573

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all RAB19B Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human RAB19B. Peptide sequence: GVYTETQQNTIGVDFTVRSLDIDGKKVKMQVWDTAGQERFRTITQSYYRS The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for RAB19B Antibody - BSA Free

Western Blot: RAB19B Antibody [NBP2-85573]

Western Blot: RAB19B Antibody [NBP2-85573]

Western Blot: RAB19B Antibody [NBP2-85573] - Host: Rabbit. Target Name: RAB19. Sample Type: RPMI-8226 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for RAB19B Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RAB19B

RAB19B, also known as Ras-related protein Rab-19, is a 24 kDa 217 amino acid protein with a longer 30kDa 264 isoform. RAB19B belongs to the Rab family and can be found in the cell membrane. Current research on RAB19B is being conducted in relation to the diseases pilocytic astrocytoma and astrocytoma. RAB19B is linked to the transport pathway where it interacts with RANBP1, RANBP2, RANGAP1, ARHGDIA and KPNB1.

Alternate Names

RAB19, member RAS oncogene family, RAB19BGTP-binding protein RAB19B, ras-related protein Rab-19

Gene Symbol

RAB19

Additional RAB19B Products

Product Documents for RAB19B Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RAB19B Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RAB19B Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RAB19B Antibody - BSA Free and earn rewards!

Have you used RAB19B Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies