Rab1A Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-55113

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Monkey

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Rab1A Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to RAB1A(RAB1A, member RAS oncogene family) The peptide sequence was selected from the middle region of RAB1A. Peptide sequence AKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGC. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Rab1A Antibody - BSA Free

Western Blot: Rab1A Antibody [NBP1-55113]

Western Blot: Rab1A Antibody [NBP1-55113]

Western Blot: Rab1A Antibody [NBP1-55113] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:312500 Positive Control: Human Muscle
Immunohistochemistry: Rab1A Antibody [NBP1-55113]

Immunohistochemistry: Rab1A Antibody [NBP1-55113]

Immunohistochemistry: Rab1A Antibody [NBP1-55113] - Formalin Fixed Paraffin Embedded Human Bronchial Epithelial Tissue. Observed Staining: Cytoplasmic staining with Primary Antibody Concentration: 1:100 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec.
Western Blot: Rab1A Antibody [NBP1-55113]

Western Blot: Rab1A Antibody [NBP1-55113]

Western Blot: Rab1A Antibody [NBP1-55113] - HeLa, Vera, HeLa transfected with mouse construct, Antibody Titration: 0.2-1 ug/ml
Western Blot: Rab1A Antibody [NBP1-55113]

Western Blot: Rab1A Antibody [NBP1-55113]

Western Blot: Rab1A Antibody [NBP1-55113] - Sample Tissue: HepG2, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 2ug/ml, Peptide Concentration: 5.0 ug/ml, Lysate Quantity: 25ug/lane/lane, Gel Concentration: 12%
Western Blot: Rab1A Antibody [NBP1-55113]

Western Blot: Rab1A Antibody [NBP1-55113]

Western Blot: Rab1A Antibody [NBP1-55113] - 1. Human Cervical Cancer Cell lysate (15ug) 2. Monkey Fibroblast Cell lysate (15ug) 3. Human Cervical Cancer Cell transfected with Rab1A-GFP (15ug) Primary Dilution: 1 : 1000 Secondary Antibody: goat anti-Rabbit Secondary Dilution: 1 : 40,000.
Western Blot: Rab1A Antibody [NBP1-55113]

Western Blot: Rab1A Antibody [NBP1-55113]

Western Blot: Rab1A Antibody [NBP1-55113] - 293T Whole Cell lysates, Antibody Dilution: 0.2 ug/ml.
Western Blot: Rab1A Antibody [NBP1-55113]

Western Blot: Rab1A Antibody [NBP1-55113]

Western Blot: Rab1A Antibody [NBP1-55113] - Analysis of HepG2 cell lysate. Antibody Dilution: 1.0 ug/ml.

Applications for Rab1A Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry-Paraffin

1:100

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Rab1A

This gene encodes a member of the Ras superfamily of GTPases. Members of the gene family cycle between inactive GDP-bound and active GTP-bound forms. This small GTPase controls vesicle traffic from the endoplasmic reticulum to the Golgi apparatus. Multipl

Long Name

Ras-related protein Rab-1A

Alternate Names

RAB1

Gene Symbol

RAB1A

UniProt

P62820 (Human)

Additional Rab1A Products

Product Documents for Rab1A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Rab1A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Rab1A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Rab1A Antibody - BSA Free and earn rewards!

Have you used Rab1A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies