RAB31 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-79921

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all RAB31 Primary Antibodies »

Product Specifications

Immunogen

The immunogen for this antibody is RAB31. Peptide sequence EVPLKDAKEYAESIGAIVVETSAKNAINIEELFQGISRQIPPLDPHENGN. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for RAB31 Antibody - BSA Free

Western Blot: RAB31 Antibody [NBP1-79921]

Western Blot: RAB31 Antibody [NBP1-79921]

Western Blot: RAB31 Antibody [NBP1-79921] - Host: Rabbit. Target: RAB31. Positive control (+): Human Brain (BR). Negative control (-): Human Liver (LI). Antibody concentration: 1ug/ml
Western Blot: RAB31 Antibody [NBP1-79921]

Western Blot: RAB31 Antibody [NBP1-79921]

Western Blot: RAB31 Antibody [NBP1-79921] - Human Fetal Brain Lysate, concentration 1 ug/ml.
Western Blot: RAB31 Antibody [NBP1-79921]

Western Blot: RAB31 Antibody [NBP1-79921]

Western Blot: RAB31 Antibody [NBP1-79921] - Lanes: Lane 1 : GFP-Rab5 transfected cos cells Lane 2: GFP-Rab31 transfected cos cells Primary Antibody Dilution: 1 : 500 Secondary Antibody: Goat anti rabbit-HRP Secondary Antibody Dilution: 1 : 5000 Gene name: RAB31 Submitted by: Ruth Herbst, Medical University Vienna.

Applications for RAB31 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RAB31

Small GTP-binding proteins of the RAB family, such as RAB31, play essential roles in vesicle and granule targeting (Bao et al., 2002 (PubMed 11784320)).(supplied by OMIM)

Alternate Names

RAB22B, RAB31, member RAS oncogene family, Ras-related protein Rab-22B, ras-related protein Rab-31

Gene Symbol

RAB31

UniProt

NP_006859 (Human)

Additional RAB31 Products

Product Documents for RAB31 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for RAB31 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RAB31 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RAB31 Antibody - BSA Free and earn rewards!

Have you used RAB31 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies