RAB33A Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85574

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all RAB33A Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human RB33A. Peptide sequence: KESQNVESIFMCLACRLKAQKSLLYRDAERQQGKVQKLEFPQEANSKTSC The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for RAB33A Antibody - BSA Free

Western Blot: RAB33A Antibody [NBP2-85574]

Western Blot: RAB33A Antibody [NBP2-85574]

Western Blot: RAB33A Antibody [NBP2-85574] - Host: Rabbit. Target Name: RB33A. Sample Type: Fetal Liver lysates. Antibody Dilution: 1.0ug/ml

Applications for RAB33A Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RAB33A

RAB33A is a member of the RAB family and is thought to be involved in vesicle transport. RAB33A is known to have interactions with RTN4, RABAC1, RTN3, ATG16L1, and RTN1. RAB33A has been studied in relation to tuberculosis and Alport syndrome.

Alternate Names

MGC1488, RAB33A, member RAS oncogene family, RabS10, ras-related protein Rab-33A, Small GTP-binding protein S10

Gene Symbol

RAB33A

Additional RAB33A Products

Product Documents for RAB33A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RAB33A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RAB33A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RAB33A Antibody - BSA Free and earn rewards!

Have you used RAB33A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies