RAB33B Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88113

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all RAB33B Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of RAB33B. Peptide sequence: ERIKIQLWDTAGQERFRKSMVQHYYRNVHAVVFVYDMTNMASFHSLPSWI The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for RAB33B Antibody - BSA Free

Western Blot: RAB33B Antibody [NBP2-88113]

Western Blot: RAB33B Antibody [NBP2-88113]

Western Blot: RAB33B Antibody [NBP2-88113] - RAB33B antibody - middle region validated by WB using Jurkat cell lysate at 1ug/ml.
Western Blot: RAB33B Antibody [NBP2-88113]

Western Blot: RAB33B Antibody [NBP2-88113]

Western Blot: RAB33B Antibody [NBP2-88113] - Sample Type: 1. Human Cervical Cancer Cell Lysate (15ug) 2. Monkey Fibroblast Cell Lysate (15ug) Primary Dilution: 1:1000 Secondary Antibody: goat anti-Rabbit Secondary Dilution: 1:40,000. Image Submitted by: Dr. Jakob Szwedo, Dr. Lupashin's Lab University of Arizona

Applications for RAB33B Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RAB33B

Protein transport. Probably involved in vesicular traffic

Alternate Names

DKFZp434G099, MGC138182, RAB33B, member RAS oncogene family, ras-related protein Rab-33B

Gene Symbol

RAB33B

Additional RAB33B Products

Product Documents for RAB33B Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RAB33B Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RAB33B Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RAB33B Antibody - BSA Free and earn rewards!

Have you used RAB33B Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies