Rab5a Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-58880
Loading...
Key Product Details
Species Reactivity
Validated:
Human, Mouse, Zebrafish
Cited:
Mouse
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot
Cited:
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
Synthetic peptides corresponding to RAB5A(RAB5A, member RAS oncogene family). The peptide sequence was selected from the middle region of RAB5A. Peptide sequence KTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCS. The peptide sequence for this immunogen was taken from within the described region.
Reactivity Notes
Mouse reactivity reported in scientific literature (PMID: 29018038).
Marker
Early Endosome Marker
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Scientific Data Images for Rab5a Antibody - BSA Free
Western Blot: Rab5a Antibody [NBP1-58880]
Western Blot: Rab5a Antibody [NBP1-58880] - Human Muscle.Applications for Rab5a Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:10 - 1:500
Immunohistochemistry-Paraffin
1:10 - 1:500
Western Blot
1.0 ug/ml
Reviewed Applications
Read 1 review rated 4 using NBP1-58880 in the following applications:
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: Rab5a
Alternate Names
RAB5A, member RAS oncogene family, RAB5RAS-associated protein RAB5A, ras-related protein Rab-5A
Gene Symbol
RAB5A
UniProt
Additional Rab5a Products
Product Documents for Rab5a Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Rab5a Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for Rab5a Antibody - BSA Free
Customer Reviews for Rab5a Antibody - BSA Free (1)
4 out of 5
1 Customer Rating
Have you used Rab5a Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Customer Images
Showing
1
-
1 of
1 review
Showing All
Filter By:
-
Application: Immunofluorescence (IF)Sample Tested: A172 Glioblastoma cellsSpecies: HumanVerified Customer | Posted 07/17/2018Untreated GBM cells stained with endosome marker Rab5 (green punctate).GBM cells grown on uncoated coverslips were fixed with 4% paraformaldehyde (ice cold) for 15 min. Following fixation, cells were rinsed thrice with PBS, permeabilized with ice-cold methanol for 10 min at 4C. Following permeabilization, coverslips were rinsed thrice with PBS, incubated with blocking buffer (5% goat serum, 0.3% Triton-X 100) for 2 h at RT. Samples were then incubated with Rab5 antibody (1:200) at 4C overnight. Following morning, coverslips were washed thrice with PBS, incubated with anti-rabbit Alexa-Fluor 488 secondary antibody (1:200) for 1 h at RT. Following three washes with PBS, coverslips were mounted on slides using Prolong Gold (with DAPI).
There are no reviews that match your criteria.
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...