RAB8A Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-79960

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptide directed towards the middle region of human RAB8AThe immunogen for this antibody is RAB8A. Peptide sequence GIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITP. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for RAB8A Antibody - BSA Free

Western Blot: RAB8A Antibody [NBP1-79960]

Western Blot: RAB8A Antibody [NBP1-79960]

Western Blot: RAB8A Antibody [NBP1-79960] - Lane 1. Human Cervical Cancer Cell lysate (15ug) 2. Monkey Fibroblast Cell lysate (15ug) 3. Human Cervical Cancer Cell transfected with mouse Rab8A-GFP (15ug) at 1 : 1000.
Western Blot: RAB8A Antibody [NBP1-79960]

Western Blot: RAB8A Antibody [NBP1-79960]

Western Blot: RAB8A Antibody [NBP1-79960] - HeLa, Vera, HeLa transfected with mouse construct, Antibody Titration: 0.2-1 ug/ml
Western Blot: RAB8A Antibody [NBP1-79960]

Western Blot: RAB8A Antibody [NBP1-79960]

Western Blot: RAB8A Antibody [NBP1-79960] - Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.

Applications for RAB8A Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RAB8A

RAB8A is encoded by this gene is a member of the RAS superfamily which are small GTP/GDP-binding proteins with an average size of 200 amino acids. The RAS-related proteins of the RAB/YPT family may play a role in the transport of proteins from the endoplasmic reticulum to the Golgi and the plasma membrane. This protein shares 97%, 96%, and 51% similarity with the dog RAB8, mouse MEL, and mouse YPT1 proteins, respectively and contains the 4 GTP/GDP-binding sites that are present in all the RAS proteins. The putative effector-binding site of this protein is similar to that of the RAB/YPT proteins. However, this protein contains a C-terminal CAAX motif that is characteristic of many RAS superfamily members but which is not found in YPT1 and the majority of RAB proteins. Although this gene was isolated as a transforming gene from a melanoma cell line, no linkage between MEL and malignant melanoma has been demonstrable. This oncogene is located 800 kb distal to MY09B on chromosome 19p13.1.

Long Name

Ras-related protein Rab-8A

Alternate Names

MEL, Oncogene c-mel, RAB8

Gene Symbol

RAB8A

Additional RAB8A Products

Product Documents for RAB8A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RAB8A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RAB8A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RAB8A Antibody - BSA Free and earn rewards!

Have you used RAB8A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...