Rabenosyn 5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-92310

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: DSPAPNPFSEEDEHPQQRLSSPLVPGNPFEEPTCINPFEIDSDSGPEAEEPIEEELLLQQIDNIKAYIFDAKQC

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (80%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Rabenosyn 5 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Rabenosyn 5 Antibody [NBP1-92310]

Immunocytochemistry/ Immunofluorescence: Rabenosyn 5 Antibody [NBP1-92310]

Immunocytochemistry/Immunofluorescence: Rabenosyn 5 Antibody [NBP1-92310] - Staining of human cell line U-2 OS shows localization to vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Rabenosyn 5 Antibody [NBP1-92310]

Immunohistochemistry-Paraffin: Rabenosyn 5 Antibody [NBP1-92310]

Immunohistochemistry-Paraffin: Rabenosyn 5 Antibody [NBP1-92310] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.
Rabenosyn 5 Antibody - BSA Free Chromatin Immunoprecipitation ChIP: Rabenosyn 5 Antibody - BSA Free

Chromatin Immunoprecipitation ChIP: Rabenosyn 5 Antibody - BSA Free

ChIP-Exo-Seq composite graph for Anti-Rabenosyn 5 tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh's Lab at Cornell University.

Applications for Rabenosyn 5 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Rabenosyn 5

DNA binding protein involved in regulation of transcription.

Alternate Names

110 kDa protein, FLJ34993, FYVE finger-containing Rab5 effector protein rabenosyn-5, FYVE-finger-containing Rab5 effector protein rabenosyn-5, MGC126210, rabenosyn-5, ZFYVE20, Zinc finger FYVE domain-containing protein 20, zinc finger, FYVE domain containing 20

Gene Symbol

RBSN

Additional Rabenosyn 5 Products

Product Documents for Rabenosyn 5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Rabenosyn 5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Rabenosyn 5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Rabenosyn 5 Antibody - BSA Free and earn rewards!

Have you used Rabenosyn 5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...