RAP30 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-17980

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RAP30. Peptide sequence: IEESSKPVRLSQQLDKVVTTNYKPVANHQYNIEYERKKKEDGKRARADKQ The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for RAP30 Antibody - BSA Free

Western Blot: RAP30 Antibody [NBP3-17980]

Western Blot: RAP30 Antibody [NBP3-17980]

Western Blot: RAP30 Antibody [NBP3-17980] - Host: Mouse. Target Name: RAP30. Sample Tissue: Mouse Small Intestine. antibody Dilution: 1ug/ml
Immunohistochemistry-Paraffin: RAP30 Antibody [NBP3-17980]

Immunohistochemistry-Paraffin: RAP30 Antibody [NBP3-17980]

Immunohistochemistry-Paraffin: RAP30 Antibody [NBP3-17980] - Rabbit Anti-RAP30 antibody. Paraffin Embedded Tissue: Human Spermatophore. Cellular Data: Epithelial cells. antibody Concentration: 4.0-8.0 ug/ml. Magnification: 400X
Western Blot: RAP30 Antibody [NBP3-17980]

Western Blot: RAP30 Antibody [NBP3-17980]

Western Blot: RAP30 Antibody [NBP3-17980] - WB Suggested Anti-RAP30 antibody Titration: 1.0ug/ml. Positive Control: HepG2 cell lysate
Immunohistochemistry: RAP30 Antibody [NBP3-17980]

Immunohistochemistry: RAP30 Antibody [NBP3-17980]

Immunohistochemistry: RAP30 Antibody [NBP3-17980] - Rabbit Anti-RAP30 antibody. Paraffin Embedded Tissue: Human Brain. Cellular Data: Neural Cells. antibody Concentration: 4.0-8.0 ug/ml. Magnification: 400X

Applications for RAP30 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RAP30

Predicted to enable RNA polymerase II general transcription initiation factor activity. Involved in transcription by RNA polymerase II. Located in microtubule cytoskeleton and nucleoplasm. Part of transcription preinitiation complex.

Alternate Names

ATP-dependent helicase GTF2F2, BTF4, General transcription factor IIF 30 kDa subunit, general transcription factor IIF subunit 2, general transcription factor IIF, polypeptide 2, 30kDa, TF2F2, TFIIF, TFIIF-beta, Transcription initiation factor IIF subunit beta, Transcription initiation factor RAP30

Gene Symbol

GTF2F2

Additional RAP30 Products

Product Documents for RAP30 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RAP30 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RAP30 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RAP30 Antibody - BSA Free and earn rewards!

Have you used RAP30 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...