RAP6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-53013

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all RAP6 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to GAPVD1(GTPase activating protein and VPS9 domains 1) The peptide sequence was selected from the N terminal of GAPVD1. Peptide sequence FKLFSEGLFSAKLFLTATLHEPIMQLLVEDEDHLETDPNKLIERFSPSQQ. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for RAP6 Antibody - BSA Free

Western Blot: RAP6 Antibody [NBP1-53013]

Western Blot: RAP6 Antibody [NBP1-53013]

Western Blot: RAP6 Antibody [NBP1-53013] - HepG2 cell lysate, concentration 0.25ug/ml.
Immunohistochemistry-Paraffin: RAP6 Antibody [NBP1-53013]

Immunohistochemistry-Paraffin: RAP6 Antibody [NBP1-53013]

Immunohistochemistry-Paraffin: RAP6 Antibody [NBP1-53013] - Human Brain Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Neural cells (indicated with arrows) 400X mgnification.

Applications for RAP6 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RAP6

GAPVD1 acts both as a GTPase-activating protein (GAP) and a guanine nucleotide exchange factor (GEF), and participates in various processes such as endocytosis, insulin receptor internalization or LC2A4/GLUT4 trafficking. It acts as a GEF for the Ras-related protein RAB31 by exchanging bound GDP for free GTP, leading to regulate LC2A4/GLUT4 trafficking. In the absence of insulin, it maintains RAB31 in an active state and promotes a futile cycle between LC2A4/GLUT4 storage vesicles and early endosomes, retaining LC2A4/GLUT4 inside the cells. Upon insulin stimulation, it is translocated to the plasma membrane, releasing LC2A4/GLUT4 from intracellular storage vesicles. It is also involved in EGFR trafficking and degradation, possibly by promoting EGFR ubiquitination and subsequent degradation by the proteasome. It has GEF activity for Rab5 and GAP activity for Ras.

Alternate Names

DKFZp434C212, GAPex-5, GAPEX5RAP6Rab5-activating protein 6, GTPase activating protein and VPS9 domains 1, GTPase-activating protein and VPS9 domain-containing protein 1, KIAA1521MGC138848, MGC138847

Gene Symbol

GAPVD1

UniProt

Q14C86-6 (Human)

Additional RAP6 Products

Product Documents for RAP6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for RAP6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RAP6 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RAP6 Antibody - BSA Free and earn rewards!

Have you used RAP6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies