RASEF Antibody (7L8S8)

Novus Biologicals | Catalog # NBP3-33294

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Rabbit IgG Clone # 7L8S8
View all RASEF Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human RASEF (NP_689786.2).

Sequence:
MEADGDGEELARLRSVFAACDANRSGRLEREEFRALCTELRVRPADAEAVFQRLDADRDGAITFQEFARGFLGSLRGGRRRDWGPLDPAPAVSEAGPETHDSEEDEGDEDAAAALATSCG

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

83 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for RASEF Antibody (7L8S8)

RASEF Antibody (7L8S8)

Western Blot: RASEF Antibody (7L8S8) [NBP3-33294] -

Western Blot: RASEF Antibody (7L8S8) [NBP3-33294] - Western blot analysis of various lysates, using RASEF Rabbit mAb at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 180s.
RASEF Antibody (7L8S8)

Western Blot: RASEF Antibody (7L8S8) [NBP3-33294] -

Western Blot: RASEF Antibody (7L8S8) [NBP3-33294] - Western blot analysis of various lysates, using RASEF Rabbit mAb at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit.
Exposure time: 60s.

Applications for RASEF Antibody (7L8S8)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: RASEF

RASEF binds predominantly GDP, and also GTP

Alternate Names

FLJ31614, RAB45, RAB45, member RAS oncogene family, RAS and EF hand domain containing, RAS and EF-hand domain containing, ras and EF-hand domain-containing protein, Ras-related protein Rab-45

Gene Symbol

RASEF

Additional RASEF Products

Product Documents for RASEF Antibody (7L8S8)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for RASEF Antibody (7L8S8)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RASEF Antibody (7L8S8)

There are currently no reviews for this product. Be the first to review RASEF Antibody (7L8S8) and earn rewards!

Have you used RASEF Antibody (7L8S8)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies