RASSF1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-89411

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Rat (90%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all RASSF1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: KFTCHYRCRALVCLDCCGPRDLGWEPAVERDTNVDEPVEWETPDLSQAEIEQKIKEYNAQINSNLFMSLNKDG

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for RASSF1 Antibody - BSA Free

RASSF1 Antibody - BSA Free Immunohistochemistry-Paraffin: RASSF1 Antibody - BSA Free [NBP1-89411]

Immunohistochemistry-Paraffin: RASSF1 Antibody - BSA Free [NBP1-89411]

Staining of human lung shows moderate cytoplasmic positivity in macrophages.
RASSF1 Antibody - BSA Free Immunohistochemistry-Paraffin: RASSF1 Antibody - BSA Free [NBP1-89411]

Immunohistochemistry-Paraffin: RASSF1 Antibody - BSA Free [NBP1-89411]

Staining of human kidney shows strong cytoplasmic positivity in cells in glomeruli.
RASSF1 Antibody - BSA Free Immunohistochemistry-Paraffin: RASSF1 Antibody - BSA Free [NBP1-89411]

Immunohistochemistry-Paraffin: RASSF1 Antibody - BSA Free [NBP1-89411]

Staining of human skin shows strong cytoplasmic positivity in subset of squamous epithelial cells.
RASSF1 Antibody - BSA Free Immunohistochemistry-Paraffin: RASSF1 Antibody - BSA Free [NBP1-89411]

Immunohistochemistry-Paraffin: RASSF1 Antibody - BSA Free [NBP1-89411]

Staining of human heart muscle shows moderate cytoplasmic positivity in cardiomyocytes.

Applications for RASSF1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RASSF1

The tumor suppressor gene RASSF1A (3p21.3), human Ras association domain family 1A, is expressed in heart, brain, placenta, lung, liver, skeletal muscle, kidney, pancreas, spleen, thymus, prostate, testis, small intestine, colon, and peripheral blood leukocytes. RASSF1A expression is inhibited by hypermethylation of the CpG island including the promoter and early transcribed regions of the human RASSF1A gene. Hypermethylated RASSF1A promoter is observed in primary tumors. Furthermore, RASSF1A is related with cell cycle regulation, apoptosis and microtubule stability. Agathanggelou A. et al

Alternate Names

123F2, NORE2A, pancreas-specific ras association domain family 1 protein, Ras association (RalGDS/AF-6) domain family member 1, ras association domain-containing protein 1, RASSF1A, RDA32cardiac-specific ras association domain family 1 protein, REH3P21, tumor suppressor protein RDA32, WUGSC:H_LUCA12.5

Gene Symbol

RASSF1

Additional RASSF1 Products

Product Documents for RASSF1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for RASSF1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RASSF1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RASSF1 Antibody - BSA Free and earn rewards!

Have you used RASSF1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies