RB associated KRAB repressor Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-55962

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all RB associated KRAB repressor Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: EYNECMEALDNEAVFIAHKRAYIGEKPYEWNDSGPDFIQMSNFNAYQRSQMEMKPF

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for RB associated KRAB repressor Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: RB associated KRAB repressor Antibody [NBP2-55962]

Immunocytochemistry/ Immunofluorescence: RB associated KRAB repressor Antibody [NBP2-55962]

Immunocytochemistry/Immunofluorescence: RB associated KRAB repressor Antibody [NBP2-55962] - Staining of human cell line MCF7 shows localization to nucleoplasm.

Applications for RB associated KRAB repressor Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RB associated KRAB repressor

RB associated KRAB repressor, also known as ZNF769, consists of a 83 kDa 714 and a shorter 12 kDa 113 isoform. Its function is to promote AR-dependent transcription by encoding a nuclear protein. Current research on RB associated KRAB repressor is being conducted in its relationship to retinoblastoma, hyperaldosteronism and familial hyperaldosteronism. RB associated KRAB repressor is known to interact with SUMO1, RB1, AR and SMARCAD1.

Alternate Names

hRBaK, RB-associated KRAB repressor, RB-associated KRAB zinc finger, RB-associated KRAB zinc finger protein, ZNF769Zinc finger protein 769

Gene Symbol

RBAK

Additional RB associated KRAB repressor Products

Product Documents for RB associated KRAB repressor Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for RB associated KRAB repressor Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RB associated KRAB repressor Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RB associated KRAB repressor Antibody - BSA Free and earn rewards!

Have you used RB associated KRAB repressor Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies