RBBP6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-58777

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all RBBP6 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TMEEYNNDNTAPAEDVIIMIQVPQSKWDKDDFESEEEDVKSTQPISSVGKPASVIKNVSTKPSNIVKYPEKESEPSEKIQKFTKDVSHE

Reactivity Notes

Mouse 82%, Rat 83%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for RBBP6 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: RBBP6 Antibody [NBP2-58777]

Immunocytochemistry/ Immunofluorescence: RBBP6 Antibody [NBP2-58777]

Immunocytochemistry/Immunofluorescence: RBBP6 Antibody [NBP2-58777] - Staining of human cell line MCF7 shows localization to nuclear speckles.

Applications for RBBP6 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RBBP6

The retinoblastoma tumor suppressor (RBBP6) protein binds with many other proteins. In various human cancers, pRB suppresses cellular proliferation and is inactivated. Cell cycle-dependent phosphorylation regulates the activity of pRB. This gene encodes a protein which binds to underphosphorylated but not phosphorylated pRB. Multiple alternatively spliced transcript variants that encode different isoforms have been found for this gene.

Alternate Names

E3 ubiquitin-protein ligase RBBP6, EC 6.3.2.-, MY038, P2PR, P2P-R, p53-associated cellular protein of testis, PACTDKFZp761B2423, Proliferation potential-related protein, Protein P2P-R, RB-binding Q-protein 1, RBQ1, RBQ-1, retinoblastoma binding protein 6, Retinoblastoma-binding protein 6DKFZp686P0638, Retinoblastoma-binding Q protein 1, SNAMA

Gene Symbol

RBBP6

Additional RBBP6 Products

Product Documents for RBBP6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for RBBP6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RBBP6 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RBBP6 Antibody - BSA Free and earn rewards!

Have you used RBBP6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies