RBMY1A1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57363

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all RBMY1A1 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to RBMY1A1(RNA binding motif protein, Y-linked, family 1, member A1) The peptide sequence was selected from the N terminal of RBMY1A1. Peptide sequence MSYSRGLIPVKRGPSSRSGGPPPKKSAPSAVARSNSWMGSQGPMSQRREN. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for RBMY1A1 Antibody - BSA Free

Western Blot: RBMY1A1 Antibody [NBP1-57363]

Western Blot: RBMY1A1 Antibody [NBP1-57363]

Western Blot: RBMY1A1 Antibody [NBP1-57363] - Human Liver cell lysate, concentration 0.2-1 ug/ml.

Applications for RBMY1A1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RBMY1A1

RBMY1A1 is a protein containing an RNA-binding motif in the N-terminus and four SRGY (serine, arginine, glycine, tyrosine) boxes in the C-terminus. The gene that encodes RBMY1A1 is Y-linked. RBMY1A1 may be involved in spermatogenesis. It is required for sperm development, possibly by participating in pre-mRNA splicing in the testis.

Alternate Names

MGC181956, RBM, RBM1, RBM2, RBMY, RBMY1C, RNA binding motif protein, Y chromosome, family 1, member A1, RNA binding motif protein, Y-linked, family 1, member A1, RNA binding protein, RNA-binding motif protein 1, RNA-binding motif protein 2, RNA-binding motif protein, Y chromosome, family 1 member A1/C, y chromosome RNA recognition motif 1, YRRM1, YRRM2

Gene Symbol

RBMY1A1

UniProt

Q15414 (Human)

Additional RBMY1A1 Products

Product Documents for RBMY1A1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for RBMY1A1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RBMY1A1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RBMY1A1 Antibody - BSA Free and earn rewards!

Have you used RBMY1A1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies