RBMY1F Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP2-94712

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human RBMY1F (NP_689798.1). MVEADHPGKLFIGGLNRETNEKMLKAVFGKHGPISEVLLIKDRTSKSRGFAFITFENPADAKNAAKDMNGTSLHGKAIKV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for RBMY1F Antibody - Azide and BSA Free

Western Blot: RBMY1F AntibodyAzide and BSA Free [NBP2-94712]

Western Blot: RBMY1F AntibodyAzide and BSA Free [NBP2-94712]

Western Blot: RBMY1F Antibody [NBP2-94712] - Analysis of extracts of rat kidney, using RBMY1F at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 1s.

Applications for RBMY1F Antibody - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: RBMY1F

RBMY1F encodes a protein containing an RNA-binding motif in the N-terminus and four SRGY (serine, arginine, glycine, tyrosine) boxes in the C-terminus. Multiple copies of this gene are found in the AZFb azoospermia factor region of chromosome Y and the encoded protein is thought to be involved in spermatogenesis. Most copies of this locus are pseudogenes, although six highly similar copies have full-length ORFs and are considered functional. Four functional copies of this gene are found within inverted repeat IR2; two functional copies of this gene are found in palindrome P3, along with two copies of PTPN13-like, Y-linked.

Alternate Names

MGC33094, RNA binding motif protein, Y-linked, family 1, member F, RNA-binding motif protein, Y chromosome, family 1 member F/J, Y chromosome RNA recognition motif 2, YRRM2

Gene Symbol

RBMY1F

Additional RBMY1F Products

Product Documents for RBMY1F Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RBMY1F Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for RBMY1F Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review RBMY1F Antibody - Azide and BSA Free and earn rewards!

Have you used RBMY1F Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...