RC74 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-57534

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (94%), Rat (95%). Backed by our 100% Guarantee.

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all RC74 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: QPTSGKKRKRVSDDVPDCKVLKPLLSGSIPVEQFVQTLEKHGFSDIKVEDTAKGHIVLLQEAETLIQIEEDSTHIICDNDEMLRVRLRDLVLKFLQKF

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for RC74 Antibody - BSA Free

Western Blot: RC74 Antibody [NBP2-57534]

Western Blot: RC74 Antibody [NBP2-57534]

Western Blot: RC74 Antibody [NBP2-57534] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: RC74 Antibody [NBP2-57534]

Immunocytochemistry/ Immunofluorescence: RC74 Antibody [NBP2-57534]

Immunocytochemistry/Immunofluorescence: RC74 Antibody [NBP2-57534] - Staining of human cell line SK-MEL-30 shows localization to nucleoplasm.
RC74 Antibody - BSA Free Chromatin Immunoprecipitation ChIP: RC74 Antibody - BSA Free

Chromatin Immunoprecipitation ChIP: RC74 Antibody - BSA Free

ChIP-Exo-Seq composite graph for Anti-RC74 tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh's Lab at Cornell University.

Applications for RC74 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RC74

Formation of the mature 3' ends of the vast majority of cellular mRNAs occurs through cleavage and polyadenylation and requires a cleavage and polyadenylation specificity factor (CPSF) containing, among other proteins, CPSF-73 and CPSF-100. RC-74 is an exclusively nuclear protein found in HeLa cells that has similar characteristics to CPSF-100. Like the complex that forms between CPSF-100 and CPSF-73, studies show that RC-74 may form a similar complex with RC-68 that is independent from the CPSF complex. This RC-68 / RC-74 complex may be involved in a pre-mRNA processing event other than cleavage and polyadenylation, such as the 3' end processing of a distinct subset of cellular pre-mRNAs encoding proteins required for G(1) progression and entry into S phase.

Alternate Names

CPSF2L, FLJ10871, Int9, integrator complex subunit 9, Protein related to CPSF subunits of 74 kDa, RC74, RC-74

Gene Symbol

INTS9

Additional RC74 Products

Product Documents for RC74 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for RC74 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RC74 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RC74 Antibody - BSA Free and earn rewards!

Have you used RC74 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies