RED1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-86772

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human RED1. Peptide sequence: QLSNGGGGGPGRKRPLEEGSNGHSKYRLKKRRKTPGPVLPKNALMQLNEI The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for RED1 Antibody - BSA Free

Western Blot: RED1 Antibody [NBP2-86772]

Western Blot: RED1 Antibody [NBP2-86772]

Western Blot: RED1 Antibody [NBP2-86772] - WB Suggested Anti-ADARB1 Antibody Titration: 1.25ug/ml. ELISA Titer: 1:1562500. Positive Control: HepG2 cell lysate
Western Blot: RED1 Antibody [NBP2-86772]

Western Blot: RED1 Antibody [NBP2-86772]

Western Blot: RED1 Antibody [NBP2-86772] - ADARB1 antibody - N-terminal region validated by WB using Mouse brains at 1:1000.

Applications for RED1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RED1

RED1 encodes the enzyme responsible for pre-mRNA editing of the glutamate receptor subunit B by site-specific deamination of adenosines. Studies in rat found that this enzyme acted on its own pre-mRNA molecules to convert an AA dinucleotide to an AI dinucleotide which resulted in a new splice site. Alternative splicing of this gene results in several transcript variants, some of which have been characterized by the presence or absence of an ALU cassette insert and a short or long C-terminal region. [provided by RefSeq]

Alternate Names

ADAR2a, ADAR2ADAR2g, ADAR2a-L1, ADAR2a-L2, ADAR2a-L3, ADAR2b, ADAR2c, adenosine deaminase, RNA-specific, B1, double-stranded RNA-specific editase 1, DRABA2, DRADA2hRED1, EC 3.5, human dsRNA adenosine deaminase DRADA2, human dsRNA adenosine deaminase DRADA2b, EC 3.510adenosine deaminase, RNA-specific, B1 (homolog of rat RED1), RED1 homolog, RED1ADAR2d, RNA editase, RNA editing deaminase 1, RNA-editing deaminase 1, RNA-editing enzyme 1, RNA-specific, B1 (RED1 homolog rat)

Gene Symbol

ADARB1

Additional RED1 Products

Product Documents for RED1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RED1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RED1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RED1 Antibody - BSA Free and earn rewards!

Have you used RED1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...