Loading...
Key Product Details
Species Reactivity
Human, Mouse
Applications
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit
Format
BSA Free
Loading...
Product Specifications
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of human RED1. Peptide sequence: QLSNGGGGGPGRKRPLEEGSNGHSKYRLKKRRKTPGPVLPKNALMQLNEI The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Scientific Data Images for RED1 Antibody - BSA Free
Western Blot: RED1 Antibody [NBP2-86772]
Western Blot: RED1 Antibody [NBP2-86772] - WB Suggested Anti-ADARB1 Antibody Titration: 1.25ug/ml. ELISA Titer: 1:1562500. Positive Control: HepG2 cell lysateWestern Blot: RED1 Antibody [NBP2-86772]
Western Blot: RED1 Antibody [NBP2-86772] - ADARB1 antibody - N-terminal region validated by WB using Mouse brains at 1:1000.Applications for RED1 Antibody - BSA Free
Application
Recommended Usage
Western Blot
1.0 ug/ml
Formulation, Preparation, and Storage
Purification
Protein A purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
1 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: RED1
Alternate Names
ADAR2a, ADAR2ADAR2g, ADAR2a-L1, ADAR2a-L2, ADAR2a-L3, ADAR2b, ADAR2c, adenosine deaminase, RNA-specific, B1, double-stranded RNA-specific editase 1, DRABA2, DRADA2hRED1, EC 3.5, human dsRNA adenosine deaminase DRADA2, human dsRNA adenosine deaminase DRADA2b, EC 3.510adenosine deaminase, RNA-specific, B1 (homolog of rat RED1), RED1 homolog, RED1ADAR2d, RNA editase, RNA editing deaminase 1, RNA-editing deaminase 1, RNA-editing enzyme 1, RNA-specific, B1 (RED1 homolog rat)
Gene Symbol
ADARB1
Additional RED1 Products
Product Documents for RED1 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for RED1 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for RED1 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review RED1 Antibody - BSA Free and earn rewards!
Have you used RED1 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...