REEP1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-69643

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all REEP1 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to REEP1(receptor accessory protein 1) The peptide sequence was selected from the C terminal of REEP1. Peptide sequence ERLRSFSMQDLTTIRGDGAPAPSGPPPPGSGRASGKHGQPKMSRSASESA. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for REEP1 Antibody - BSA Free

Western Blot: REEP1 Antibody [NBP1-69643]

Western Blot: REEP1 Antibody [NBP1-69643]

Western Blot: REEP1 Antibody [NBP1-69643] - This Anti-REEP1 antibody was used in Western Blot of Fetal Muscle tissue lysate at a concentration of 1ug/ml.
Western Blot: REEP1 Antibody [NBP1-69643]

Western Blot: REEP1 Antibody [NBP1-69643]

Western Blot: REEP1 Antibody [NBP1-69643] - Human Fetal Brain, Antibody Dilution: 1.0 ug/ml.

Applications for REEP1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: REEP1

REEP1 belongs to the DP1 family and may enhance the cell surface expression of odorant receptors.

Alternate Names

C2ORF23, chromosome 2 open reading frame 23, receptor accessory protein 1, receptor expression-enhancing protein 1, SPG31FLJ13110

Gene Symbol

REEP1

UniProt

Q9H902 (Human)

Additional REEP1 Products

Product Documents for REEP1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for REEP1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for REEP1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review REEP1 Antibody - BSA Free and earn rewards!

Have you used REEP1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies