REM1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-55506

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all REM1 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to REM1(RAS (RAD and GEM)-like GTP-binding 1) Antibody(against the N terminal of REM1. Peptide sequence SDSEGSWEALYRVVLLGDPGVGKTSLASLFAGKQERDLHEQLGEDVYERT. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for REM1 Antibody - BSA Free

Western Blot: REM1 Antibody [NBP1-55506]

Western Blot: REM1 Antibody [NBP1-55506]

Western Blot: REM1 Antibody [NBP1-55506] - Hela cell lysate, concentration 0.2-1 ug/ml.

Applications for REM1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: REM1

The protein encoded by this gene is a GTPase and member of the RAS-like GTP-binding protein family. The encoded protein is expressed in endothelial cells, where it promotes reorganization of the actin cytoskeleton and morphological changes in the cells.

Alternate Names

GESGD:REM, GTPase GES, GTPase-regulating endothelial cell sprouting, GTP-binding protein REM 1, MGC48669, Rad and Gem-like GTP-binding protein 1, RAS (RAD and GEM)-like GTP-binding, RAS (RAD and GEM)-like GTP-binding 1, REM

Gene Symbol

REM1

UniProt

O75628 (Human)

Additional REM1 Products

Product Documents for REM1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for REM1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for REM1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review REM1 Antibody - BSA Free and earn rewards!

Have you used REM1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies