Renalase Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-98475

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Renalase Primary Antibodies »

Product Specifications

Immunogen

The immunogen for this antibody is Renalase - middle region. Peptide sequence GMKIGVPWSCRYLSSHPCICFISIDNKKRNIESSECGPSVVIQTTVPFGV. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Renalase Antibody - BSA Free

Western Blot: Renalase Antibody [NBP1-98475]

Western Blot: Renalase Antibody [NBP1-98475]

Western Blot: Renalase Antibody [NBP1-98475] - Positive Control: Lane 1: 40 ug Mouse kidney tissue lysate Lane 2: 40 ug Mouse kidney tissue lysate Primary Antibody Dilution : 1:500 Secondary Antibody : Anti-rabbit-HRP Secondry Antibody Dilution : 1:2500
Western Blot: Renalase Antibody [NBP1-98475]

Western Blot: Renalase Antibody [NBP1-98475]

Western Blot: Renalase Antibody [NBP1-98475] - Titration: 1.0 ug/ml Positive Control: Mouse Heart.
Western Blot: Renalase Antibody [NBP1-98475]

Western Blot: Renalase Antibody [NBP1-98475]

Western Blot: Renalase Antibody [NBP1-98475] - Sample Tissue: Human Fetal Brain Antibody Dilution: 1.0 ug/ml

Applications for Renalase Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Renalase

Rnls is a probable FAD-dependent amine oxidase secreted by the kidney, which circulates in blood and modulates cardiac function and systemic blood pressure. It degrades catecholamines such as dopamine, norepinephrine and epinephrine in vitro. It lowers blood pressure in vivo by decreasing cardiac contractility and heart rate and preventing a compensatory increase in peripheral vascular tone, suggesting a causal link to the increased plasma catecholamine and heightened cardiovascular risk. High concentrations of catecholamines activate plasma renalase and promotes its secretion and synthesis.

Alternate Names

C10orf59, RNLS

Gene Symbol

RNLS

UniProt

NP_001161290 (Mouse)

Additional Renalase Products

Product Documents for Renalase Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Renalase Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Oxidases and Oxygenases
Redox Enzymes

Customer Reviews for Renalase Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Renalase Antibody - BSA Free and earn rewards!

Have you used Renalase Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies