RENBP Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88138

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all RENBP Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of RENBP. Peptide sequence: PHSEAMIAFLMGYSDSGDPVLLRLFYQVAEYTFRQFRDPEYGEWFGYLSR The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for RENBP Antibody - BSA Free

Western Blot: RENBP Antibody [NBP2-88138]

Western Blot: RENBP Antibody [NBP2-88138]

Western Blot: RENBP Antibody [NBP2-88138] - WB Suggested Anti-RENBP Antibody. Titration: 1.0 ug/ml. Positive Control: 721_B Whole CellRENBP is supported by BioGPS gene expression data to be expressed in 721_B

Applications for RENBP Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RENBP

RENBP, also known as N-acylglucosamine 2-epimerase, is a 49kDa 427 amino acid protein with a shorter 29kDa 254 isoform produced by alternative splicing. RENBP functions as a catalyzer in the conversion of N-acetylglucosamine to N-acetylmannosamine. Current research is being conducted on RENBP in relation to sialuria, Wilms tumor, allergic rhinitis, myopathy, vascular disease, hypertension, nephropathy, proteinuria and aldosteronism. RENBP has been linked to the amino sugar and nucleotide sugar metabolism pathways where it interacts with HEXA, HEXB, GNE, REN and ZBED1.

Alternate Names

AGE, EC 5.1.3.8, GlcNAc 2-epimerase, N-acetyl-D-glucosamine 2-epimerase, N-acylglucosamine 2-epimerase, RBP, renin binding protein, Renin-binding protein, RNBP

Gene Symbol

RENBP

Additional RENBP Products

Product Documents for RENBP Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RENBP Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RENBP Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RENBP Antibody - BSA Free and earn rewards!

Have you used RENBP Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies