Retinoblastoma binding protein 1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-86774

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human Retinoblastoma binding protein 1. Peptide sequence: NSSKCTPVKHLNVSKPQKLARSPARISPHIKDGEKDKHREKHPNSSPRTY The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Retinoblastoma binding protein 1 Antibody - BSA Free

Western Blot: Retinoblastoma binding protein 1 Antibody [NBP2-86774]

Western Blot: Retinoblastoma binding protein 1 Antibody [NBP2-86774]

Western Blot: Retinoblastoma binding protein 1 Antibody [NBP2-86774] - WB Suggested Anti-ARID4A Antibody Titration: 1.25ug/ml. Positive Control: HepG2 cell lysate

Applications for Retinoblastoma binding protein 1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Retinoblastoma binding protein 1

ARID4A (AT-rich interactive domain-containing protein 4A) is also known as RbBP1 (retinoblastoma binding protein 1) and is a retinoblastoma binding protein and member of the AT-rich interaction domain (ARID) family of proteins. In addition to the ARID DNA binding domain, ARID4A also contains a chromo domain and a TUDOR domain, indicating a function in chromatin organization and protein-protein interactions with methylated protein substrates. ARID4A is implicated to be involved in chromatin remodeling and epigenetic modifications and to play a role in the pathogenesis of cancer.

Alternate Names

AT rich interactive domain 4A (RBP1-like), RBBP-1, RBP-1, RBP1ARID domain-containing protein 4A, retinoblastoma binding protein 1, Retinoblastoma-binding protein 1RBBP1AT-rich interactive domain-containing protein 4A

Gene Symbol

ARID4A

Additional Retinoblastoma binding protein 1 Products

Product Documents for Retinoblastoma binding protein 1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Retinoblastoma binding protein 1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Retinoblastoma binding protein 1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Retinoblastoma binding protein 1 Antibody - BSA Free and earn rewards!

Have you used Retinoblastoma binding protein 1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...