Retinol Binding Protein RBP Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57677

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to RBP1(retinol binding protein 1, cellular) The peptide sequence was selected from the middle region of RBP1. Peptide sequence IIRTLSTFRNYIMDFQVGKEFEEDLTGIDDRKCMTTVSWDGDKLQCVQKG. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Retinol Binding Protein RBP Antibody - BSA Free

Western Blot: Retinol Binding Protein RBP Antibody [NBP1-57677]

Western Blot: Retinol Binding Protein RBP Antibody [NBP1-57677]

Western Blot: Retinol Binding Protein RBP Antibody [NBP1-57677] - HCT116 cell lysate, concentration 2.5 ug/ml.

Applications for Retinol Binding Protein RBP Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Retinol Binding Protein RBP

RBP1 is the carrier protein involved in the transport of retinol (vitamin A alcohol) from the liver storage site to peripheral tissue. Vitamin A is a fat-soluble vitamin necessary for growth, reproduction, differentiation of epithelial tissues, and vision.RBP1 is the carrier protein involved in the transport of retinol (vitamin A alcohol) from the liver storage site to peripheral tissue. Vitamin A is a fat-soluble vitamin necessary for growth, reproduction, differentiation of epithelial tissues, and vision. The gene harbors four exons encoding 24, 59, 33, and 16 amino acid residues respectively. The second intervening sequence alone occupies 19 kb of the 21 kb of the gene.

Alternate Names

C, Cellular retinol-binding protein, CRABP-I, CRBP1CRBP-I, CRBPCellular retinol-binding protein I, CRBPI, RBPC, retinol binding protein 1, cellular, retinol-binding protein 1, retinol-binding protein 1, cellular

Gene Symbol

RBP1

UniProt

Additional Retinol Binding Protein RBP Products

Product Documents for Retinol Binding Protein RBP Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Retinol Binding Protein RBP Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Retinol Binding Protein RBP Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Retinol Binding Protein RBP Antibody - BSA Free and earn rewards!

Have you used Retinol Binding Protein RBP Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...