retinol dehydrogenase 8 (all trans) Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-09458

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human retinol dehydrogenase 8 (all trans) (NP_056540). Peptide sequence FDTNFFGAVRLVKAVLPGMKRRRQGHIVVISSVMGLQGVIFNDVYAASKF

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for retinol dehydrogenase 8 (all trans) Antibody - BSA Free

Western Blot: retinol dehydrogenase 8 (all trans) Antibody [NBP3-09458]

Western Blot: retinol dehydrogenase 8 (all trans) Antibody [NBP3-09458]

Western Blot: retinol dehydrogenase 8 (all trans) Antibody [NBP3-09458] - Western blot analysis of retinol dehydrogenase 8 (all trans) in A549 Whole Cell as a positive control. Antibody dilution at 1.0 ug/ml

Applications for retinol dehydrogenase 8 (all trans) Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: retinol dehydrogenase 8 (all trans)

All-trans-retinol dehydrogenase (RDH8) is a visual cycle enzyme that reduces all-trans-retinal to all-trans-retinol in the presence of NADPH (Rattner et al., 2000 [PubMed 10753906]). It is a member of the short chain dehydrogenase/reductase family and is located in the outer segments of photoreceptors; hence it is also known as photoreceptor retinol dehydrogenase. It is important in the visual cycle by beginning the rhodopsin regeneration pathway by reducing all-trans-retinal, the product of bleached and hydrolysed rhodopsin (Rando, 2001 [PubMed 11710234]). This is a rate-limiting step in the visual cycle (Saari et al., 1998 [PubMed 9667000]).[supplied by OMIM]

Alternate Names

photoreceptor outer segment all-trans retinol dehydrogenase, PRRDH, retinol dehydrogenase 8, retinol dehydrogenase 8 (all-trans), SDR28C2, short chain dehydrogenase/reductase family 28C, member 2

Gene Symbol

RDH8

Additional retinol dehydrogenase 8 (all trans) Products

Product Documents for retinol dehydrogenase 8 (all trans) Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for retinol dehydrogenase 8 (all trans) Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for retinol dehydrogenase 8 (all trans) Antibody - BSA Free

There are currently no reviews for this product. Be the first to review retinol dehydrogenase 8 (all trans) Antibody - BSA Free and earn rewards!

Have you used retinol dehydrogenase 8 (all trans) Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...