REV1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-09940

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all REV1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human REV1 (XP_005264024). Peptide sequence INLIALPAFSQVDPEVFAALPAELQRELKAAYDQRQRQGENSTHQQSASA

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

137 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for REV1 Antibody - BSA Free

Western Blot: REV1 Antibody [NBP3-09940]

Western Blot: REV1 Antibody [NBP3-09940]

Western Blot: REV1 Antibody [NBP3-09940] - Western blot analysis of REV1 in Fetal Lung lysates. Antibody dilution at 1.0ug/ml

Applications for REV1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: REV1

REV1L is the human homolog of the S. cerevisiae mutagenesis protein Rev1. The REV1 protein is conserved from yeast to humans. All REV1 proteins contain a BRCT domain, which is important in protein-protein interactions.

Alternate Names

AIBP80, Alpha integrin-binding protein 80, DNA repair protein REV1, EC 2.7.7.-, FLJ21523, MGC163283, MGC26225, REV1 (yeast homolog)- like, REV1 homolog (S. cerevisiae), REV1- like, REV1L, REV1-like (yeast), Rev1-like terminal deoxycytidyl transferase

Gene Symbol

REV1

Additional REV1 Products

Product Documents for REV1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for REV1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for REV1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review REV1 Antibody - BSA Free and earn rewards!

Have you used REV1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies