RFC1 Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-54960
Loading...
Key Product Details
Species Reactivity
Human
Applications
Validated:
Immunocytochemistry/ Immunofluorescence
Cited:
Western Blot, Block/Neutralize
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: QDVVALMDTYYLMKEDFENIMEISSWGGKPSPFSKLDPKVKAAFTRAYNKEAHLTPYSLQAIKASRHSTSPSLDSEYNEELNEDDSQSDEKDQDAI
Reactivity Notes
Mouse 81%, Rat 81%
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Description
Novus Biologicals Rabbit RFC1 Antibody - BSA Free (NBP2-54960) is a polyclonal antibody validated for use in WB and ICC/IF. Anti-RFC1 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
Scientific Data Images for RFC1 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence: RFC1 Antibody [NBP2-54960]
Immunocytochemistry/Immunofluorescence: RFC1 Antibody [NBP2-54960] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.Western Blot: RFC1 Antibody - BSA Free [NBP2-54960] -
DEK- or NUMA1-depleted cells showed abnormal PCNA accumulation.A–C U2OS cells were transfected with DEK or NUMA1 siRNAs. 48 h after transfection, cells were irradiated through a 5 um micropore filter with 100 J/m2 of UV-C, fixed at the indicated time points, and immunostained for PCNA and CPD. A Representative images of PCNA co-localization with CPDs. Scale bar, 20 μm. B Quantification of PCNA co-localization with CPDs (%). Each colored asterisk represents the statistical analysis in comparison to si-Con. Quantification of PCNA signal intensity at CPD foci. A.U., arbitrary unit. B, C S phase cells with S phase-specific PCNA foci staining pattern were excluded from the analysis. Error bars represent SEM (n = 3). D–G U2OS cells were transfected with siRNAs as indicated. 48 h after transfection, cells were irradiated through a 5 um micropore filter with 100 J/m2 of UV-C and subjected to immunostaining D–F or lysed for Western blot G. D Representative images. Scale bar, 20 μm. E, F Quantification of PCNA signal intensity at CPD foci (A. U.). S phase cells with S phase-specific PCNA foci staining pattern were excluded from the analysis. Images from the 30 min E and 4 h F time points were analyzed using the same parameters, and the graphs are shown separately for each time point. Error bars represent SEM (n = 3). Statistical analysis: one-way ANOVA B, C, E, F, ***P < 0.005, **P < 0.01, *P < 0.05, and ns not significant. Image collected and cropped by CiteAb from the following open publication (https://www.nature.com/articles/s41420-025-02823-z), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for RFC1 Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: RFC1
Long Name
Replication Factor C 1
Alternate Names
MHCBFB, PO-GA, RECC1, RFC140
Gene Symbol
RFC1
Additional RFC1 Products
Product Documents for RFC1 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for RFC1 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for RFC1 Antibody - BSA Free
Customer Reviews for RFC1 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review RFC1 Antibody - BSA Free and earn rewards!
Have you used RFC1 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...