RFC1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-54960

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Validated:

Immunocytochemistry/ Immunofluorescence

Cited:

Western Blot, Block/Neutralize

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: QDVVALMDTYYLMKEDFENIMEISSWGGKPSPFSKLDPKVKAAFTRAYNKEAHLTPYSLQAIKASRHSTSPSLDSEYNEELNEDDSQSDEKDQDAI

Reactivity Notes

Mouse 81%, Rat 81%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit RFC1 Antibody - BSA Free (NBP2-54960) is a polyclonal antibody validated for use in WB and ICC/IF. Anti-RFC1 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for RFC1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: RFC1 Antibody [NBP2-54960]

Immunocytochemistry/ Immunofluorescence: RFC1 Antibody [NBP2-54960]

Immunocytochemistry/Immunofluorescence: RFC1 Antibody [NBP2-54960] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.
RFC1 Antibody - BSA Free

Western Blot: RFC1 Antibody - BSA Free [NBP2-54960] -

DEK- or NUMA1-depleted cells showed abnormal PCNA accumulation.A–C U2OS cells were transfected with DEK or NUMA1 siRNAs. 48 h after transfection, cells were irradiated through a 5 um micropore filter with 100 J/m2 of UV-C, fixed at the indicated time points, and immunostained for PCNA and CPD. A Representative images of PCNA co-localization with CPDs. Scale bar, 20 μm. B Quantification of PCNA co-localization with CPDs (%). Each colored asterisk represents the statistical analysis in comparison to si-Con. Quantification of PCNA signal intensity at CPD foci. A.U., arbitrary unit. B, C S phase cells with S phase-specific PCNA foci staining pattern were excluded from the analysis. Error bars represent SEM (n = 3). D–G U2OS cells were transfected with siRNAs as indicated. 48 h after transfection, cells were irradiated through a 5 um micropore filter with 100 J/m2 of UV-C and subjected to immunostaining D–F or lysed for Western blot G. D Representative images. Scale bar, 20 μm. E, F Quantification of PCNA signal intensity at CPD foci (A. U.). S phase cells with S phase-specific PCNA foci staining pattern were excluded from the analysis. Images from the 30 min E and 4 h F time points were analyzed using the same parameters, and the graphs are shown separately for each time point. Error bars represent SEM (n = 3). Statistical analysis: one-way ANOVA B, C, E, F, ***P < 0.005, **P < 0.01, *P < 0.05, and ns not significant. Image collected and cropped by CiteAb from the following open publication (https://www.nature.com/articles/s41420-025-02823-z), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for RFC1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RFC1

RFC1 is encoded by this gene is the large subunit of replication factor C, which is a five subunit DNA polymerase accessory protein. Replication factor C is a DNA-dependent ATPase that is required for eukaryotic DNA replication and repair. The protein acts as an activator of DNA polymerases, binds to the 3' end of primers, and promotes coordinated synthesis of both strands. It also may have a role in telomere stability. [provided by RefSeq]

Long Name

Replication Factor C 1

Alternate Names

MHCBFB, PO-GA, RECC1, RFC140

Gene Symbol

RFC1

Additional RFC1 Products

Product Documents for RFC1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RFC1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for RFC1 Antibody - BSA Free

Customer Reviews for RFC1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RFC1 Antibody - BSA Free and earn rewards!

Have you used RFC1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...