RGC32 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-56182

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (94%), Rat (94%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all RGC32 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LSDALCEFDAVLADFASPFHERHFHYEEHLERMK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for RGC32 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: RGC32 Antibody [NBP2-56182]

Immunocytochemistry/ Immunofluorescence: RGC32 Antibody [NBP2-56182]

Immunocytochemistry/Immunofluorescence: RGC32 Antibody [NBP2-56182] - Staining of human cell line CACO-2 shows localization to nucleus & nucleoli.

Applications for RGC32 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Reviewed Applications

Read 1 review rated 1 using NBP2-56182 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RGC32

RGC32 is thought to regulate cell cycle progression. It is induced by p53 in response to DNA damage, or by sublytic levels of complement system proteins that result in activation of the cell cycle. The encoded protein localizes to the cytoplasm during interphase and to centrosomes during mitosis. The protein forms a complex with polo-like kinase 1. The protein also translocates to the nucleus in response to treatment with complement system proteins, and can associate with and increase the kinase activity of cell division cycle 2 protein. In different assays and cell types, overexpression of this protein has been shown to activate or suppress cell cycle progression. [provided by RefSeq]

Alternate Names

bA157L14.2, chromosome 13 open reading frame 15, KIAA0564, RGC-32MGC87338, RGC32response gene to complement 32 protein

Gene Symbol

RGCC

Additional RGC32 Products

Product Documents for RGC32 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for RGC32 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for RGC32 Antibody - BSA Free

Customer Reviews for RGC32 Antibody - BSA Free (1)

1 out of 5
1 Customer Rating
5 Stars
0%
4 Stars
0%
3 Stars
0%
2 Stars
0%
1 Stars
100%

Have you used RGC32 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 1 of 1 review Showing All
Filter By:
Clear Filters X
  • RGC32 Antibody
    Name: Parisa Shabani
    Application: Immunohistochemistry-Frozen
    Sample Tested: Adult heart
    Species: Rat
    Verified Customer | Posted 06/27/2022
    Representative dual-immunofluorescence staining of rat endothelial cell antigen-1 (RECA-1) and RGC32 in rat heart frozen sections
    RGC32 Antibody - BSA Free NBP2-56182
    Bio-Techne Response
    This review was submitted through the legacy Novus Innovators Program, reflecting a new species or application tested on a primary antibody.

There are no reviews that match your criteria.

Showing  1 - 1 of 1 review Showing All

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies