RGC32 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88148

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human RGC32. Peptide sequence: HERHFHYEEHLERMKRRSSASVSDSSGFSDSESADSLYRNSFSFSDEKLN The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for RGC32 Antibody - BSA Free

Western Blot: RGC32 Antibody [NBP2-88148]

Western Blot: RGC32 Antibody [NBP2-88148]

Western Blot: RGC32 Antibody [NBP2-88148] - Host: Rabbit. Target Name: RGCC. Sample Type: MCF7 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for RGC32 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RGC32

RGC32 is thought to regulate cell cycle progression. It is induced by p53 in response to DNA damage, or by sublytic levels of complement system proteins that result in activation of the cell cycle. The encoded protein localizes to the cytoplasm during interphase and to centrosomes during mitosis. The protein forms a complex with polo-like kinase 1. The protein also translocates to the nucleus in response to treatment with complement system proteins, and can associate with and increase the kinase activity of cell division cycle 2 protein. In different assays and cell types, overexpression of this protein has been shown to activate or suppress cell cycle progression. [provided by RefSeq]

Alternate Names

bA157L14.2, chromosome 13 open reading frame 15, KIAA0564, RGC-32MGC87338, RGC32response gene to complement 32 protein

Gene Symbol

RGCC

Additional RGC32 Products

Product Documents for RGC32 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RGC32 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RGC32 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RGC32 Antibody - BSA Free and earn rewards!

Have you used RGC32 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...