RGR Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84243

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all RGR Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of RGR. Peptide sequence: GKSGHLQVPALIAKMVPTINAINYALGNEMVCRGIWQCLSPQKREKDRTK The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for RGR Antibody - BSA Free

Western Blot: RGR Antibody [NBP2-84243]

Western Blot: RGR Antibody [NBP2-84243]

Western Blot: RGR Antibody [NBP2-84243] - WB Suggested Anti-RGR Antibody. Titration: 1.0 ug/ml. Positive Control: PANC1 Whole CellRGR is supported by BioGPS gene expression data to be expressed in PANC1

Applications for RGR Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RGR

Retinal G protein-coupled receptor RPE, a member of the Opsin subfamily of GPCRs has been shown to be involved in retinitis pigmentosa. It preferentially binds all-trans retinal rather than 11-cis retinal, which is normally found in rhodopsin. RPE has two isoforms produced by alternative splicing. Retinal G protein-coupled receptor RPE has been reported to be expressed in the eye. ESTs have been isolated from normal human brain and eye libraries and from human brain and colon cancer libraries.

Alternate Names

retinal G protein coupled receptor, RGR-opsin, RP44, RPE retinal G-protein coupled receptor, RPE-retinal G protein-coupled receptor

Gene Symbol

RGR

Additional RGR Products

Product Documents for RGR Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RGR Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RGR Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RGR Antibody - BSA Free and earn rewards!

Have you used RGR Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies