RGS1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-82337

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of mouse Rgs1. Peptide sequence: GMKSAKSKDILSAEEVMQWSQSLEKLLANQTGQNVFGRFLKSEFSEENIE The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for RGS1 Antibody - BSA Free

Western Blot: RGS1 Antibody [NBP2-82337]

Western Blot: RGS1 Antibody [NBP2-82337]

Western Blot: RGS1 Antibody [NBP2-82337] - WB Suggested Anti-Rgs1 Antibody Titration: 5.0ug/ml. Positive Control: SP2/0 cell lysate

Applications for RGS1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RGS1

RGS1 encodes a member of the regulator of G protein signalling family. This protein is located on the cytosolic side of the plasma membrane and contains a conserved, 120 amino acid motif called the RGS domain. The protein attenuates the signalling activity of G proteins by binding to activated, GTP bound G alpha subunits and acting as a GTPase activating protein (GAP), increasing the rate of conversion of the GTP to GDP. This hydrolysis allows the G alpha subunits to bind G beta/gamma subunit heterodimers, forming inactive G protein heterotrimers, thereby terminating the signal.

Alternate Names

1R20, 1R20Early response protein 1R20, B-cell activation protein BL34, BL34, Early response protein 1R20, HEL-S-87, IER1, IR20, IR20immediate-early response 1, B-cell specific, regulator of G-protein signaling 1, regulator of G-protein signalling 1, RGS1

Gene Symbol

RGS1

Additional RGS1 Products

Product Documents for RGS1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RGS1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RGS1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RGS1 Antibody - BSA Free and earn rewards!

Have you used RGS1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...