RHAG Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-62670

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all RHAG Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to RHAG(Rh-associated glycoprotein) The peptide sequence was selected form the middle region of RHAG. Peptide sequence FGAVLGKTSPTQMLIMTILEIVFFAHNEYLVSEIFKASDIGASMTIHAFG. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for RHAG Antibody - BSA Free

Western Blot: RHAG Antibody [NBP1-62670]

Western Blot: RHAG Antibody [NBP1-62670]

Western Blot: RHAG Antibody [NBP1-62670] - Titration: 1.25ug/ml Positive Control: HepG2 cell lysate.

Applications for RHAG Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RHAG

The Rh blood group antigens are associated with human erythrocyte membrane proteins of approximately 30 kD, the so-called Rh30 polypeptides. Heterogeneously glycosylated membrane proteins of 50 and 45 kD, the Rh50 glycoproteins, are coprecipitated with the Rh30 polypeptides on immunoprecipitation with anti-Rh-specific mono- and polyclonal antibodies. The Rh antigens appear to exist as a multisubunit complex of CD47, LW, glycophorin B, and play a critical role in the Rh50 glycoprotein.The Rh blood group antigens (MIM 111700) are associated with human erythrocyte membrane proteins of approximately 30 kD, the so-called Rh30 polypeptides. Heterogeneously glycosylated membrane proteins of 50 and 45 kD, the Rh50 glycoproteins, are coprecipitated with the Rh30 polypeptides on immunoprecipitation with anti-Rh-specific mono- and polyclonal antibodies. The Rh antigens appear to exist as a multisubunit complex of CD47 (MIM 601028), LW (MIM 111250), glycophorin B (MIM 111740), and play a critical role in the Rh50 glycoprotein.[supplied by OMIM].

Alternate Names

ammonium transporter Rh type A, CD241, CD241 antigen, Erythrocyte membrane glycoprotein Rh50, Erythrocyte plasma membrane 50 kDa glycoprotein, Rh family type A glycoprotein, Rh type A glycoprotein, RH50, Rh50A, RH50ARh50, Rh50GP, Rh-associated glycoprotein, Rhesus associated polypeptide, 50-KD, Rhesus blood group family type A glycoprotein, Rhesus blood group-associated ammonia channel, Rhesus blood group-associated glycoproteinRH2, SLC42A1

Gene Symbol

RHAG

OMIM

NP_000315 (Human)

UniProt

Q02094 (Human)

Additional RHAG Products

Product Documents for RHAG Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for RHAG Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RHAG Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RHAG Antibody - BSA Free and earn rewards!

Have you used RHAG Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies