RHBDF1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59725

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to RHBDF1(rhomboid 5 homolog 1 (Drosophila)) The peptide sequence was selected from the N terminal of RHBDF1. Peptide sequence KDWEKAPEQADLTGGALDRSELERSHLMLPLERGWRKQKEGAAAPQPKVR. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

97 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for RHBDF1 Antibody - BSA Free

Western Blot: RHBDF1 Antibody [NBP1-59725]

Western Blot: RHBDF1 Antibody [NBP1-59725]

Western Blot: RHBDF1 Antibody [NBP1-59725] - Sample Tissue: 721_B Whole Cell, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1ug/ml, Peptide Concentration: 5ug/ml, Lysate Quantity: 25ug/lane/Lane, Gel Concentration: 0.
Western Blot: RHBDF1 Antibody [NBP1-59725]

Western Blot: RHBDF1 Antibody [NBP1-59725]

Western Blot: RHBDF1 Antibody [NBP1-59725] - Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.

Applications for RHBDF1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RHBDF1

RHBDF1 is a seven-transmembrane protein with a long N-terminal cytoplasmic extension that comprises half of the polypeptide sequence, and is found in the endoplasmic reticulum and Golgi, but not on the cell surface. RHBDF1 has a pivotal role in sustaining growth signals in epithelial cancer cells and thus may serve as a therapeutic target for treating epithelial cancers.

Alternate Names

C16orf8, chromosome 16 open reading frame 8, Dist1, EGFR-RS, epidermal growth factor receptor, related sequence, FLJ2235, FLJ22357, gene-89, gene-90, hDist1, p100hRho, Rhomboid 5 homolog 1, rhomboid 5 homolog 1 (Drosophila), rhomboid family 1, rhomboid family 1 (Drosophila), rhomboid family member 1

Gene Symbol

RHBDF1

UniProt

Additional RHBDF1 Products

Product Documents for RHBDF1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RHBDF1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RHBDF1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RHBDF1 Antibody - BSA Free and earn rewards!

Have you used RHBDF1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...