RhoB Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP2-94104

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 100-190 of human RhoB (NP_004031.1). VPEVKHFCPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYLECSAKTKEGVREVFETATRAALQKRYGSQNGCI

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for RhoB Antibody - Azide and BSA Free

RhoB Antibody - Azide and BSA Free

Western Blot: RhoB Antibody - Azide and BSA Free [NBP2-94104] -

Western Blot: RhoB Antibody - Azide and BSA Free [NBP2-94104] - Western blot analysis of extracts of Rat lung, using RhoB Rabbit pAb antibody (A2819) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.
RhoB Antibody - Azide and BSA Free

Western Blot: RhoB Antibody - Azide and BSA Free [NBP2-94104] -

Western Blot: RhoB Antibody - Azide and BSA Free [NBP2-94104] - Western blot analysis of extracts of various cell lines, using RhoB Rabbit pAb antibody (A2819) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Applications for RhoB Antibody - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: RhoB

Mediates apoptosis in neoplastically transformed cells after DNA damage. Not essential for development but affects cell adhesion and growth factor signaling in transformed cells. Plays a negative role in tumorigenesis as deletion causes tumor formation. Involved in intracellular protein trafficking of a number of proteins. Targets PKN1 to endosomes and is involved in trafficking of the EGF receptor from late endosomes to lysosomes. Also required for stability and nuclear trafficking of AKT1/AKT which promotes endothelial cell survival during vascular development.

Alternate Names

ARH6MSTP081, ARHBAplysia RAS-related homolog 6, h6, MST081, oncogene RHO H6, ras homolog gene family, member B, Rho cDNA clone 6, RHOH6RhoB, rho-related GTP-binding protein RhoB

Gene Symbol

RHOB

Additional RhoB Products

Product Documents for RhoB Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RhoB Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for RhoB Antibody - Azide and BSA Free

Customer Reviews for RhoB Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review RhoB Antibody - Azide and BSA Free and earn rewards!

Have you used RhoB Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...