RhoGAP Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-58620

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (95%), Rat (95%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all RhoGAP Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PLAHPEDMDPSDNYAEPIDTIFKQKGYSDEIYVVPDDSQNRIKIRNSFVNNTQGDEENGFSDRTSKSHGERRPSKYKYKSKTLFSKAKSYYRRTHSDASDDE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for RhoGAP Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: RhoGAP Antibody [NBP2-58620]

Immunocytochemistry/ Immunofluorescence: RhoGAP Antibody [NBP2-58620]

Immunocytochemistry/Immunofluorescence: RhoGAP Antibody [NBP2-58620] - Staining of human cell line A549 shows localization to cytosol & endoplasmic reticulum. Antibody staining is shown in green.

Applications for RhoGAP Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RhoGAP

The p190 Rho GTPase activating protein RhoGAP) family includes two closely related proteins, p190-A and p190-B. p190-B contains an N-terminal GTPase domain and a C-terminal Rho-GAP domain (1). p190-B can be directly phosphorylated on a single identified tyrosine residue by the activated insulin and IGF-1 receptors. This phosphorylation causes p190-B to translocate to the lipid rafts of the plasma membrane, where it can facilitate the inactivation of the Rho GTPase. P190-B also has been shown to be tyrosine phosphorylated by c-Src and v-Src. Additionall; the GAP domain of p190-B as shown to attenuate signal-transducing activity of Rac, Rho and CDC42 (2-3).

Alternate Names

growth factor independent 2, p100 RasGAP-associated p105 protein, p105 RhoGAP, p190-BGFI2, p190BRhoGAP, Rho GTPase activating protein 5, rho GTPase-activating protein 5, RHOGAP5, Rho-type GTPase-activating protein 5

Gene Symbol

ARHGAP5

Additional RhoGAP Products

Product Documents for RhoGAP Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for RhoGAP Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RhoGAP Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RhoGAP Antibody - BSA Free and earn rewards!

Have you used RhoGAP Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies