RhoGAP Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88152

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all RhoGAP Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human RhoGAP. Peptide sequence: YLSDNTRESTHQSEDVFLPSPRDCFPYNNYPDSDDDTEAPPPYSPIGDDV The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for RhoGAP Antibody - BSA Free

Western Blot: RhoGAP Antibody [NBP2-88152]

Western Blot: RhoGAP Antibody [NBP2-88152]

Western Blot: RhoGAP Antibody [NBP2-88152] - Host: Rabbit. Target Name: RHG05. Sample Type: HepG2 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for RhoGAP Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RhoGAP

The p190 Rho GTPase activating protein RhoGAP) family includes two closely related proteins, p190-A and p190-B. p190-B contains an N-terminal GTPase domain and a C-terminal Rho-GAP domain (1). p190-B can be directly phosphorylated on a single identified tyrosine residue by the activated insulin and IGF-1 receptors. This phosphorylation causes p190-B to translocate to the lipid rafts of the plasma membrane, where it can facilitate the inactivation of the Rho GTPase. P190-B also has been shown to be tyrosine phosphorylated by c-Src and v-Src. Additionall; the GAP domain of p190-B as shown to attenuate signal-transducing activity of Rac, Rho and CDC42 (2-3).

Alternate Names

growth factor independent 2, p100 RasGAP-associated p105 protein, p105 RhoGAP, p190-BGFI2, p190BRhoGAP, Rho GTPase activating protein 5, rho GTPase-activating protein 5, RHOGAP5, Rho-type GTPase-activating protein 5

Gene Symbol

ARHGAP5

Additional RhoGAP Products

Product Documents for RhoGAP Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RhoGAP Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RhoGAP Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RhoGAP Antibody - BSA Free and earn rewards!

Have you used RhoGAP Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies