Ribophorin I Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-69260

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Canine

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to RPN1(ribophorin I) The peptide sequence was selected from the N terminal of Ribophorin I. Peptide sequence TSRATSFLLALEPELEARLAHLGVQVKGEDEEENNLEVRETKIKGKSGRF. The peptide sequence for this immunogen was taken from within the described region.

Specificity

This product is specific to Subunit or Isoform: 1.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

69 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Ribophorin I Antibody - BSA Free

Western Blot: Ribophorin I Antibody [NBP1-69260]

Western Blot: Ribophorin I Antibody [NBP1-69260]

Western Blot: ribophorin I Antibody [NBP1-69260] - This Anti-RPN1 antibody was used in Western Blot of MCF7 tissue lysate at a concentration of 1ug/ml.

Applications for Ribophorin I Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Ribophorin I

Ribophorin I is a type I integral membrane protein found only in the rough endoplasmic reticulum. It is part of an N-oligosaccharyl transferase complex that links high mannose oligosaccharides to asparagine residues found in the Asn-X-Ser/Thr consensus motif of nascent polypeptide chains. Ribophorin I forms part of the regulatory subunit of the 26S proteasome and may mediate binding of ubiquitin-like domains to this proteasome. This gene encodes a type I integral membrane protein found only in the rough endoplasmic reticulum. The encoded protein is part of an N-oligosaccharyl transferase complex that links high mannose oligosaccharides to asparagine residues found in the Asn-X-Ser/Thr consensus motif of nascent polypeptide chains. This protein forms part of the regulatory subunit of the 26S proteasome and may mediate binding of ubiquitin-like domains to this proteasome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Alternate Names

DKFZp686B16177, dolichyl-diphosphooligosaccharide-protein glycosyltransferase 67 kDa subunit, Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 67 kDa subunit, dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1, EC 2.4.1.119, oligosaccharyltransferase 1 homolog, OST1, ribophorin IRBPH1, Ribophorin-1, RPN-I

Gene Symbol

RPN1

Additional Ribophorin I Products

Product Documents for Ribophorin I Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Ribophorin I Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Ribophorin I Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Ribophorin I Antibody - BSA Free and earn rewards!

Have you used Ribophorin I Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...