Ribosomal Protein L17 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-48845

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: RAHGRINPYMSSPCHIEMILTEKEQIVPKPEEEVAQKKKISQKKLK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Ribosomal Protein L17 Antibody - BSA Free

Western Blot: Ribosomal Protein L17 Antibody [NBP2-48845]

Western Blot: Ribosomal Protein L17 Antibody [NBP2-48845]

Western Blot: Ribosomal Protein L17 Antibody [NBP2-48845] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: Ribosomal Protein L17 Antibody [NBP2-48845]

Immunocytochemistry/ Immunofluorescence: Ribosomal Protein L17 Antibody [NBP2-48845]

Immunocytochemistry/Immunofluorescence: Ribosomal Protein L17 Antibody [NBP2-48845] - Staining of human cell line U-2 OS shows localization to nucleoli, cytosol & endoplasmic reticulum.
Immunohistochemistry: Ribosomal Protein L17 Antibody [NBP2-48845]

Immunohistochemistry: Ribosomal Protein L17 Antibody [NBP2-48845]

Immunohistochemistry: Ribosomal Protein L17 Antibody [NBP2-48845] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Applications for Ribosomal Protein L17 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Ribosomal Protein L17

Ribosomal Protein L17, also known as 60S ribosomal protein L23, is a 21kDa 184 amino acid protein with a shorter 17kDa 146 isoform and a longer 26kDa 228 isoform produced by alternative splicing. Ribosomal Protein L17 belongs to the L22P family of ribosomal proteins and can be found in the cytoplasm. Current research is being conducted on Ribosomal Protein L17 and its relationship to Treacher Collins syndrome, gastric cancer, pancreatitis and malaria. Ribosomal Protein L17 has been linked to the ribosome assembly, protein folding, cell proliferation and cell growth pathways where it interacts with RPL4, RPL11, RPL26, RPL27A and RPL35.

Alternate Names

RPL17, RPL23

Gene Symbol

RPL17

Additional Ribosomal Protein L17 Products

Product Documents for Ribosomal Protein L17 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Ribosomal Protein L17 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Ribosomal Protein L17 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Ribosomal Protein L17 Antibody - BSA Free and earn rewards!

Have you used Ribosomal Protein L17 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies