RIG-I Antibody (2J8D5)

Novus Biologicals | Catalog # NBP3-33366

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Rabbit IgG Clone # 2J8D5
View all RIG-I Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 241-455 of human RIG-I (NP_055129.2).

Sequence:
FKPRNYQLELALPAMKGKNTIICAPTGCGKTFVSLLICEHHLKKFPQGQKGKVVFFANQIPVYEQQKSVFSKYFERHGYRVTGISGATAENVPVEQIVENNDIIILTPQILVNNLKKGTIPSLSIFTLMIFDECHNTSKQHPYNMIMFNYLDQKLGGSSGPLPQVIGLTASVGVGDAKNTDEALDYICKLCASLDASVIATVKHNLEELEQVVYK

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

107 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for RIG-I Antibody (2J8D5)

RIG-I Antibody (2J8D5)

Western Blot: RIG-I Antibody (2J8D5) [NBP3-33366] -

Western Blot: RIG-I Antibody (2J8D5) [NBP3-33366] - Western blot analysis of various lysates, using RIG-I Rabbit mAb at 1:2000 dilution. THP-1 cells were treated by LPS (1 ug/ml) at 37C for 6 hours.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 3s.
RIG-I Antibody (2J8D5)

Western Blot: RIG-I Antibody (2J8D5) [NBP3-33366] -

Western Blot: RIG-I Antibody (2J8D5) [NBP3-33366] - Western blot analysis of lysates from RAW264.7 cells, using RIG-I Rabbit mAb at 1:2000 dilution. Raw264. 7 cells were treated by LPS (1 ug/ml) at 37C for 8 hours.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 3s.

Applications for RIG-I Antibody (2J8D5)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Western Blot

1:1000 - 1:5000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.09% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: RIG-I

RIG-I, also known as DDX58, consists of a 106.6 kDa and a 101.4 kDa isoform and is involved in recognizing viruses and activating a response. Current research is being conducted with diseases and disorders such as hepatitis, rubella, influenza, rabies, hemorrhagic fever, lupus nephritis, and tick-borne encephalitis. The protein interacts in pathways such as NF-kappa signaling, cytosolic DNA-sensing, measles, influenza A, and mediated induction pathways with proteins such as CYLD, ZC3HAV1, DDX3X, MAVS, and WRNIP1.

Long Name

RIG-I

Alternate Names

DDX58, RIGI

Gene Symbol

RIGI

Additional RIG-I Products

Product Documents for RIG-I Antibody (2J8D5)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for RIG-I Antibody (2J8D5)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RIG-I Antibody (2J8D5)

There are currently no reviews for this product. Be the first to review RIG-I Antibody (2J8D5) and earn rewards!

Have you used RIG-I Antibody (2J8D5)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies