Ring finger protein 138 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88154

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human Ring finger protein 138. Peptide sequence: LFQIVPVTCPICVSLPWGDPSQITRNFVSHLNQRHQFDYGEFVNLQLDEE The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Ring finger protein 138 Antibody - BSA Free

Western Blot: Ring finger protein 138 Antibody [NBP2-88154]

Western Blot: Ring finger protein 138 Antibody [NBP2-88154]

Western Blot: Ring finger protein 138 Antibody [NBP2-88154] - WB Suggested Anti-RNF138 Antibody Titration: 0.2-1 ug/ml. Positive Control: Transfected 293T
Western Blot: Ring finger protein 138 Antibody [NBP2-88154]

Western Blot: Ring finger protein 138 Antibody [NBP2-88154]

Western Blot: Ring finger protein 138 Antibody [NBP2-88154] - Host: Rabbit. Target Name: RNF138. Sample Type: Jurkat. Antibody Dilution: 1.0ug/mlRNF138 is supported by BioGPS gene expression data to be expressed in Jurkat

Applications for Ring finger protein 138 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Ring finger protein 138

Ring finger protein 138 is 245 amino acids long, weighs approximately 28 kDa, and has a shorter isoform that is 151 amino acids long and weighs approximately 17 kDa. Ring finger protein 138 functions as E3 ubiquitin-protein ligases that works with NLK to ubiquitinate and degrade TCF and LEF. Current research is being done on diseases and disorders related to this protein including Crohn's disease and ataxia. Ring finger protein 138 has also been shown to have interactions with PCBP4, QKI, TAF9, C6orf165, and UBE2D2 in pathways such as the antigen processing, Wnt/beta-catenin-mediated signaling, and immune system pathways.

Alternate Names

E3 ubiquitin-protein ligase RNF138, EC 6.3.2.-, hNARF, HSD-4, MGC8758, NARF, Nemo-like kinase-associated RING finger protein, ring finger protein 138NLK-associated RING finger protein, STRIN

Gene Symbol

RNF138

Additional Ring finger protein 138 Products

Product Documents for Ring finger protein 138 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Ring finger protein 138 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Ring finger protein 138 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Ring finger protein 138 Antibody - BSA Free and earn rewards!

Have you used Ring finger protein 138 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...