RNA polymerase I termination factor Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-74129

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all RNA polymerase I termination factor Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to the middle region of TTF1. Immunizing peptide sequence KNSESTLFDSVEGDGAMMEEGVKSRPRQKKTQACLASKHVQEAPRLEPAN. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

103 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for RNA polymerase I termination factor Antibody - BSA Free

Western Blot: RNA polymerase I termination factor Antibody [NBP1-74129]

Western Blot: RNA polymerase I termination factor Antibody [NBP1-74129]

Western Blot: RNA polymerase I termination factor Antibody [NBP1-74129] - Human Fetal Liver Lysate, Antibody Titration: 1 ug/ml, and Gel concentration: 6-18%

Applications for RNA polymerase I termination factor Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RNA polymerase I termination factor

This gene encodes a transcription termination factor that is localized to the nucleolus and plays a critical role in ribosomal gene transcription. The encoded protein mediates the termination of RNA polymerase I transcription by binding to Sal box terminator elements downstream of pre-rRNA coding regions. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. This gene shares the symbol/alias 'TFF1' with another gene, NK2 homeobox 1, also known as thyroid transcription factor 1, which plays a role in the regulation of thyroid-specific gene expression.

Alternate Names

RNA polymerase I termination factor, transcription termination factor 1, Transcription termination factor I, transcription termination factor, RNA polymerase I, TTF-1, TTF-I

Gene Symbol

TTF1

UniProt

Q15361 (Human)

Additional RNA polymerase I termination factor Products

Product Documents for RNA polymerase I termination factor Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for RNA polymerase I termination factor Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RNA polymerase I termination factor Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RNA polymerase I termination factor Antibody - BSA Free and earn rewards!

Have you used RNA polymerase I termination factor Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies