RNF135 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88163

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RNF135. Peptide sequence: DILHDLEEIQEKLQESVTWKEAPEAQMQGELLEAPSSSSCPLPDQSHPAL The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for RNF135 Antibody - BSA Free

Western Blot: RNF135 Antibody [NBP2-88163]

Western Blot: RNF135 Antibody [NBP2-88163]

Western Blot: RNF135 Antibody [NBP2-88163] - Host: Rabbit. Target: RNF135. Positive control (+): Human Placenta (PL). Negative control (-): HeLa (HL). Antibody concentration: 1ug/ml
Western Blot: RNF135 Antibody [NBP2-88163]

Western Blot: RNF135 Antibody [NBP2-88163]

Western Blot: RNF135 Antibody [NBP2-88163] - Host: Rabbit. Target Name: RNF135. Sample Tissue: Human OVCAR-3 Whole Cell. Antibody Dilution: 1ug/ml
Western Blot: RNF135 Antibody [NBP2-88163]

Western Blot: RNF135 Antibody [NBP2-88163]

Western Blot: RNF135 Antibody [NBP2-88163] - WB Suggested Anti-RNF135 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: Jurkat cell lysate
Western Blot: RNF135 Antibody [NBP2-88163]

Western Blot: RNF135 Antibody [NBP2-88163]

Western Blot: RNF135 Antibody [NBP2-88163] - Host: Rabbit. Target Name: RNF135. Sample Tissue: Human THP-1 Whole Cell. Antibody Dilution: 3ug/ml

Applications for RNF135 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RNF135

RNF135 is encoded by this gene contains a RING finger domain, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions. This gene is located in a chromosomal region known to be frequently deleted in patients with neurofibromatosis. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq]

Alternate Names

E3 ubiquitin-protein ligase RNF135, EC 6.3.2.-, MGC13061, REUL, ring finger protein 135RIG-I E3 ubiquitin ligase, Riplet

Gene Symbol

RNF135

Additional RNF135 Products

Product Documents for RNF135 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RNF135 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RNF135 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RNF135 Antibody - BSA Free and earn rewards!

Have you used RNF135 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...