Ropporin 1-like Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88171

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human Ropporin 1-like. Peptide sequence: GYFSALSRGDPLPVKDRMEMPTATQKTDTGLTQGLLKVLHKQCHHKRYVE The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Ropporin 1-like Antibody - BSA Free

Western Blot: Ropporin 1-like Antibody [NBP2-88171]

Western Blot: Ropporin 1-like Antibody [NBP2-88171]

Western Blot: Ropporin 1-like Antibody [NBP2-88171] - WB Suggested Anti-ROPN1L Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:12500. Positive Control: HepG2 cell lysate

Applications for Ropporin 1-like Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Ropporin 1-like

Ropporin 1-like is encoded by this gene is a sperm protein, which interacts with A-kinase anchoring protein, AKAP3, through the amphipathic helix region of AKAP3. Type II regulatory subunit of cAMP-dependent protein kinase (PKARII) also binds to this helix domain of AKAP3, which allows PKARII to be targeted to specific subcellular compartments. It is suggested that sperm contains several proteins that bind to AKAPs in a manner similar to PKARII, and this encoded protein may be one of them. [provided by RefSeq]

Alternate Names

AKAP-associated sperm protein, ASPFLJ23003, FLJ25776, radial spoke head 11 homolog, rhophilin associated tail protein 1-like, ROPN1-like protein, ropporin 1-like, ropporin-1-like protein, RSPH11

Gene Symbol

ROPN1L

Additional Ropporin 1-like Products

Product Documents for Ropporin 1-like Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Ropporin 1-like Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Ropporin 1-like Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Ropporin 1-like Antibody - BSA Free and earn rewards!

Have you used Ropporin 1-like Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...